Jaringan Komputer : Bab 8

Jaringan Komputer

• Sekumpulan komputer otonom yang saling terhubung satu dengan yang lainnya menggunakan protokol komunikasi melalui media transmisi pada suatu jaringan komunikasi data
• Beberapa komputer yang saling terhubung dan saling bertukar informasi.
• Dua komputer atau lebih yang saling terhubung dengan sebuah media, sehingga dapat saling berbagi resource dan berkomunikasi.
• Gabungan antara teknologi komputer dan teknologi komunikasi.
• Sekelompok komputer yang saling berhubungan dalam area tertentu.
• Menghubungkan beberapa komputer stand – alone untuk dapat berbagi (sharing).

Ciri-ciri jaringan komputer:
• berbagi perangkat keras (hardware).
• berbagi perangkat lunak (software).
• berbagi saluran komunikasi (internet).
• berbagi data dengan mudah.
• memudahkan komunikasi antar pemakai jaringan.

Dukungan Jaringan Komputer
• Resource Sharing > penggunaan sumber data & daya secara bersama-sama oleh sejumlah stasiun komputer yang terhubung.
• Information Sharing > berarti dalam suatu jaringan berlaku pemakaian program2 aplikasi secara bersama-sama.
• Network Access > kondisi dimana para pengguna dalam suatu jaringan dapat pula mengakses jaringan komputer lain yang terhubung.

Sejarah & Latar Belakang
Pada tahun 1940-an di Amerika ada sebuah penelitian yang ingin memanfaatkan sebuah perangkat komputer secara bersama. Ditahun 1950-an ketika jenis komputer mulai membesar sampai terciptanya super komputer, karena mahalnya harga perangkat komputer maka ada tuntutan sebuah komputer mesti melayani beberapa terminal. Dari sinilah maka muncul konsep distribusi proses berdasarkan waktu yang dikenal dengan nama TSS (Time Sharing System), bentuk pertama kali jaringan (network) komputer diaplikasikan. Pada sistem TSS beberapa terminal terhubung secara seri ke sebuah host komputer.

Selanjutnya konsep ini berkembang menjadi proses distribusi (Distributed Processing). Dalam proses ini beberapa host komputer mengerjakan sebuah pekerjaan besar secara paralel untuk melayani beberapa terminal yang tersambung secara seri disetiap host komputer.

Selanjutnya ketika harga-harga komputer kecil sudah mulai menurun dan konsep proses distribusi sudah matang, maka penggunaan komputer dan jaringannya sudah mulai beragam dari mulai menangani proses bersama maupun komunikasi antar komputer (Peer to Peer System) saja tanpa melalui komputer pusat. Untuk itu mulailah berkembang teknologi jaringan lokal yang dikenal dengan sebutan LAN (Local Area Network). Demikian pula ketika Internet mulai diperkenalkan, maka sebagian besar LAN yang berdiri sendiri mulai berhubungan dan terbentuklah jaringan raksasa ditingkat dunia yang disebut dengan istilah WAN (Word Area Network).
Local Area Network (LAN), merupakan jaringan milik pribadi di dalam sebuah gedung atau kampus yang berukuran sampai beberapa kilometer. LAN seringkali digunakan untuk menghubungkan komputer-komputer pribadi dan workstation dalam kantor suatu perusahaan atau pabrik-pabrik untuk memakai bersama sumberdaya (resouce, misalnya printer) dan saling bertukar informasi.
Jenis Jaringan

Metropolitan Area Network (MAN), padadasarnyamerupakanversiLAN yang berukuranlebihbesardanbiasanyamenggunakanteknologiyang samadenganLAN. MAN dapatmencakupkantor-kantorperusahaanyang letaknyaberdekatanataujugasebuahkotadandapatdimanfaatkanuntukkeperluanpribadi(swasta) atauumum. MAN mampumenunjangdata dansuara, bahkandapatberhubungandenganjaringantelevisikabel.
Wide Area Network (WAN), jangkauannya mencakup daerah geografis yang luas, seringkali mencakup sebuah negara bahkan benua. WAN terdiri dari kumpulan mesin-mesin yang bertujuan untuk menjalankan program-program (aplikasi) pemakai.
Internet. Sebenarnya terdapat banyak jaringan di dunia ini, seringkali menggunakan perangkat keras dan perangkat lunak yang berbeda-beda. Orang yang terhubung ke jaringan sering berharap untuk bisa berkomunikasi dengan orang lain yang terhubung ke jaringan lainnya. Keinginan seperti ini memerlukan hubungan antar jaringan yang seringkali tidak compatibel dan berbeda. Biasanya untuk melakukan hal ini diperlukan sebuah mesin yang disebut gateway guna melakukan hubungan dan melaksanakan terjemahan yang diperlukan, baik perangkat keras maupun perangkat lunaknya. Kumpulan jaringan yang terinterkoneksi inilah yang disebut dengan internet.

Wireless (Jaringan tanpa kabel), jaringan tanpa kabel merupakan suatu solusi terhadap komukasi yang tidak bisa dilakukan dengan jaringan yang menggunakan kabel. Misalnya orang yang ingin mendapat informasi atau melakukan komunikasi walaupun sedang berada diatas mobil atau pesawat terbang, maka mutlak jaringan tanpa kabel diperlukan karena koneksi kabel tidaklah mungkin dibuat di dalam mobil atau pesawat. Saat ini jaringan tanpa kabel sudah marak digunakan dengan memanfaatkan jasa satelit dan mampu memberikan kecepatan akses yang lebih cepat dibandingkan dengan jaringan yang menggunakan kabel.

adalah suatu cara menghubungkan komputer yang satu dengan komputer lainnya sehingga membentuk jaringan. Cara yang saat ini banyak digunakan adalah Bus, Token-Ring, dan Star Network. Masing-masing topologi ini mempunyai ciri khas, dengan kelebihan dan kekurangannya sendiri.
A) Topologi Bus. Pada topologi Bus digunakan sebuah kabel tunggal atau kabel pusat di mana seluruh workstation dan server dihubungkan.
• Kelemahan dari topologi ini adalah setiap node dalam jaringan akan selalu ikut serta mengelola informasi yang dilewatkan dalam jaringan, sehingga bila terdapat gangguan di suatu node maka seluruh jaringan akan terganggu.
• Keunggulan topologi Ring adalah tidak terjadinya collision atau tabrakan pengiriman data seperti pada topologi Bus, karena hanya satu node dapat mengirimkan data pada suatu saat.

B) Topologi Star
Pada topologi Star, masing-masing workstation dihubungkan secara langsung ke server atau HUB. Keunggulan dari topologi tipe Star ini adalah bahwa dengan adanya kabel tersendiri untuk setiap workstation ke server, maka bandwidth atau lebar jalur komunikasi dalam kabel akan semakin lebar sehingga akan meningkatkan unjuk kerja jaringan secara keseluruhan. Dan juga bila terdapat gangguan di suatu jalur kabel maka gangguan hanya akan terjadi dalam komunikasi antara workstation yang bersangkutan dengan server, jaringan secara keseluruhan tidak mengalami gangguan. Kelemahan dari topologi Star adalah kebutuhan kabel yang lebih besar dibandingkan dengan topologi lainnya.

• Paling fleksibel
• Pemasangan/perubahan stasiun sangat mudah dan tidak mengganggu bagian jaringan lain
• Kontrol terpusat
• Kemudahan deteksi dan isolasi kesalahan/kerusakan pengelolaan jaringan

• Boros kabel
• Perlu penanganan khusus
• Kontrol terpusat (HUB) jadi elemen kritis

Type Jaringan
Type Jaringan terkait erat dengan sistem operasi jaringan. Ada dua type jaringan, yaitu client-server dan type jaringan peer to peer
Jaringan Client – Server
Server adalah komputer yang menyediakan fasilitas bagi komputer komputer lain didalam jaringan dan client adalah komputer-komputeryangmenerimaataumenggunakanfasilitasyangdisediakanolehserver. Serverdijaringantipeclient-serverdisebutdenganDedicatedServerkarenamurniberperansebagaiserveryangmenyediakanfasilitaskepadaworkstationdanservertersebuttidkdapatberperansebagaiworkstation.

• Kecepatanakseslebihtinggikarenapenyediaanfasilitasjaringandanpengelolaannyadilakukansecarakhususolehsatukomputer(server) yang tidakdibebanidengantugaslain sepertisebagaiworkstation.
• Sistemkeamanandanadministrasijaringanlebihbaik, karenaterdapatsebuahkomputeryang bertugassebagaiadministrator jaringan, yang mengelolaadministrasidansistemkeamananjaringan.
• Sistembackup data lebihbaik, karenapadajaringanclient-server backup dilakukanterpusatdiserver, yang akanmembackupseluruhdata yang digunakandidalamjaringan.

• Biayaoperasionalrelatiflebihmahal.
• Diperlukanadanyasatukomputerkhususyang berkemampuanlebihuntukditugaskansebagaiserver.
• Kelangsunganjaringansangattergantungpadaserver. Bilaserver mengalamigangguanmakasecarakeseluruhanjaringanakanterganggu.

JaringanPeer To Peer

• Antarkomputerdalamjaringandapatsalingberbagi-pakaifasilitasyang dimilikinyaseperti: harddisk, drive, fax/modem, printer.
• Biayaoperasionalrelatiflebihmurahdibandingkandengantipejaringanclient-server, salahsatunyakarenatidakmemerlukanadanyaserver yang memilikikemampuankhususuntukmengorganisasikandanmenyediakanfasilitasjaringan.
• Kelangsungankerjajaringantidaktergantungpadasatuserver.
• Sehinggabilasalahsatukomputer/peer matiataurusak, jaringansecarakeseluruhantidakakanmengalamigangguan.

• Troubleshooting jaringanrelatiflebihsulit, karenapadajaringantipepeer to peer setiapkomputerdimungkinkanuntukterlibatdalamkomunikasiyang ada. Di jaringanclient-server, komunikasiadalahantaraserver denganworkstation.
• Unjukkerjalebihrendahdibandingkandenganjaringanclient-server, karenasetiapkomputer/peer disampingharusmengelolapemakaianfasilitasjaringanjugaharusmengelolapekerjaanatauaplikasisendiri.
• Sistemkeamananjaringanditentukanolehmasing-masinguser denganmengaturkeamananmasing-masingfasilitasyang dimiliki.
• Karenadata jaringantersebardimasing-masingkomputerdalamjaringan, makabackup harusdilakukanolehmasing-masingkomputertersebut.

IP Address
IP address adalah alamat yang diberikan pada jaringan komputer dan peralatan jaringan yang menggunakan protokol TCP/IP. IP address terdiri atas 32 bit angka biner yang dapat dituliskan sebagai empat kelompok angka desimal yang dipisahkan oleh tanda titik seperti
IP address terdiri atas dua bagian yaitu network ID dan host ID, dimana network ID menentukan alamat jaringan komputer, sedangkan host ID menentukan alamat host (komputer, router, switch). Oleh sebab itu IP address memberikan alamat lengkap suatu host beserta alamat jaringan di mana host itu berada.
Kelas-kelas IP AddressUntuk mempermudah pemakaian, bergantung pada kebutuhan pemakai, IP address dibagi dalam tiga kelas seperti diperlihatkan pada tabel dibawah
IP address kelasA diberikanuntukjaringandenganjumlahhost yang sangatbesar. Range IP 1.xxx.xxx.xxx. –126.xxx.xxx.xxx, terdapat16.777.214 (16 juta) IP address padatiapkelasA. PadaIP address kelasA, network ID ialah8 bit pertama, sedangkanhost ID ialah24 bit berikutnya. Dengandemikian, caramembacaIP address kelasA, misalnya113.46.5.6 ialah:
Network ID = 113
Host ID = 46.5.6
IP address diatasberartihost nomor46.5.6 padanetwork nomor113. IP address kelasB biasanyadialokasikanuntukjaringanberukuransedangdanbesar. PadaIP address kelasB, network ID ialah16 bit 21 pertama, sedangkanhost ID ialah16 bit berikutnya.
Dengandemikian, caramembacaIP address kelasB, misalnya132.92.121.1 :
Network ID = 132.92
Host ID = 121.1
IP address diatasberartihost nomor121.1 padanetwork nomor132.92. Denganpanjanghost ID 16 bit, network denganIP address kelasB dapatmenampungsekitar65000 host. Range IP 128.0.xxx.xxx –191.155.xxx.xxx.
IP address kelas C awalnya digunakan untuk jaringan berukuran kecil (LAN). Host ID ialah 8 bit terakhir. Dengan konfigurasi ini, bisa dibentuk sekitar 2 juta network dengan masing-masing network memiliki 256 IP address. Range IP 192.0.0.xxx –223.255.255.x.
Pengalokasian IP address pada dasarnya ialah proses memilih network ID dan host ID yang tepat untuk suatu jaringan. Tepat atau tidaknya konfigurasi ini tergantung dari tujuan yang hendak dicapai, yaitu mengalokasikan IP address seefisien mungkin.

Domain Name System (DNS)
Domain Name System (DNS) adalah suatu sistem yang memungkinkan nama suatu host pada jaringan komputer atau internet ditranslasikan menjadi IP address. Dalam pemberian nama, DNS menggunakan arsitektur hierarki :
• Root-level domain: merupakan tingkat teratas yang ditampilkan sebagai tanda titik (.).
• Top level domain: kode kategori organisasi atau negara misalnya: .com untuk dipakai oleh perusahaan; .edu untuk dipakai oleh perguruan tinggi; .gov untuk dipakai oleh badan pemerintahan. Selain itu untuk membedakan pemakaian nama oleh suatu negara dengan negara lain digunakan tanda misalnya .id untuk Indonesia atau .au untuk australia.
• Second level domain: merupakan nama untuk organisasi atau perusahaan, misalnya: microsoft.com; yahoo.com, dan lain-lain.

IP address dan subnet mask dapat diberikan secara otomatis menggunakan Dynamic Host Configuration Protocol atau diisi secara manual. DHCP berfungsi untuk memberikan IP address secara otomatis pada komputer yang menggunakan protokol TCP/IP.
DHCP bekerja dengan relasi client-server, dimana DHCP server menyediakan suatu kelompok IP address yang dapat diberikan pada DHCP client. Dalam memberikan IP address ini, DHCP hanya meminjamkan IP address tersebut. Jadi pemberian IP address ini berlangsung secara dinamis.
Komponen Hardware dari LAN.
LAN tersusun dari beberapa elemen dasar yang meliputi komponen hardware dan software. Komponen software meliputi: Personal Computer (PC), Network Interface Card (NIC) dan Kabel. Sedangkan komponen software meliputi : Sistem Operasi Jaringan, Network Adapter Driver, Protokol Jaringan.

1. Personal Computer
Tipe personal komputer yang digunakan di dalam jaringan akan sangat menentukan unjuk kerja dari jaringan tersebut. Komputer dengan unjuk kerja tinggi akan mampu mengirim dan mengakses data dalam jaringan dengan cepat. Di dalam jaringan tipe Client-Server, komputer yang difungsikan sebagai server mutlak harus memiliki unjuk kerja lebih tinggi dibandingkan komputer-komputer lain sebagai workstation-nya, karena server akan bertugas menyediakan fasilitas dan mengelola operasional jaringan tersebut.

2. NIC
Berdasarkan tipe bus, ada beberapa tipe network interface card (nic) atau network card, yaitu ISA dan PCI. Saat ini jenis network card yang banyak digunakan, yaitu PCI.
Jenis NIC

3. Pengkabelan
Jaringan komputer pada dasarnya adalah jaringan kabel, menghubungkan satu sisi dengan sisi yang lain, namun bukan berarti kurva tertutup, bisa jadi merupakan kurva terbuka dengan terminator diujungnya). Seiring dengan perkembangan teknologi, penghubung antar komputer pun mengalami perubahan serupa, mulai dari teknologi telegraf yang memanfaatkan gelombang radio hingga teknologi serat optik dan laser menjadi tumpuan perkembangan jaringan komputer.
Hingga sekarang, teknologi jaringan komputer bisa menggunakan teknologi “kelas” museum (seperti 10BASE2 menggunakan kabel Coaxial) hingga menggunakan teknologi “langit” (seperti laser dan serat optik). Pemilihan jenis kabel sangat terkait erat dengan topologi jaringan yang digunakan. Sebagai contoh untuk jenis topologi Ring umumnya menggunakan kabel Fiber Optik (walaupun ada juga yang menggunakan twisted pair).
Topologi Bus banyak menggunakan kabel Coaxial. Kesulitan utama dari penggunaan kabel coaxial adalah sulit untuk mengukur apakah kabel coaxial yang dipergunakan benar-benar matching atau tidak. Karena kalau tidak sungguh-sungguh diukur secara benar akan merusak NIC (Network Interface Card) yang dipergunakan dan kinerja jaringan menjadi terhambat, tidak mencapai kemampuan maksimalnya. Topologi jaringan Star banyak menggunakan jenis kabel UTP.

Setiap jenis kabel mempunyai kemampuan dan spesifikasi yang berbeda, oleh karena itu dibuatlah pengenalan tipe kabel. Ada tiga jenis kabel yang dikenal secara umum, yaitu:
• Coaxial cable
• Fiber Optik
• Twisted pair (UTPunshielded twisted pair dan STP shielded twisted pair)

a. Coaxial Cable
Dikenal dua jenis kabel coaxial, yaitu thick coaxial cable (mempunyai diameter lumayan besar) dan thin coaxial cable (mempunyai diameter lebih kecil).
Thick coaxial cable (Kabel Coaxial “gemuk”)
Kabel coaxial jenis ini dispesifikasikan berdasarkan standar IEEE 802.3 10BASE5, dimana kabel ini mempunyai diameter rata-rata 12mm, dan biasanya diberi warna kuning. Kabel jenis ini biasa disebut sebagai standard ethernet atau thick Ethernet, atau hanya disingkat ThickNet, atau bahkan hanya disebut sebagai yellow cable.
Aturan Kabel Coaxial Gemuk
• Setiap ujung harus diterminasi dengan terminator 50-ohm (dianjurkan menggunakan terminator yang sudah dirakit, bukan menggunakan satu buah resistor 50-ohm 1 watt, sebab resistor mempunyai disipasi tegangan yang cukup lebar).
• Maksimum 3 segment dengan peralatan terhubung (attached devices) atau berupa populated segments.
• Setiap kartu jaringan mempunyai pemancar tambahan (external transceiver).
• Setiap segment maksimum berisi 100 perangkat jaringan, termasuk dalam hal ini repeaters.
• Maksimumpanjangkabelper segment adalah1.640 feet (atausekitar500 meter).
• Maksimumjarakantarsegment adalah4.920 feet (atausekitar1500 meter).
• Setiapsegment harusdiberiground.
• Jarakmaksimumantaratap ataupencabangdarikabelutamakeperangkat(device) adalah16 feet (sekitar5 meter).
• Jarakminimum antartap adalah8 feet (sekitar2,5 meter).

Thin coaxial cable (“Kurus”)
Kabel coaxial jenis ini banyak dipergunakan di kalangan radio amatir, terutama untuk transceiver yang tidak memerlukan output daya yang besar. Untuk digunakan sebagai perangkat jaringan, kabel coaxial jenis ini harus memenuhi standar IEEE 802.3 10BASE2, dimana diameter rata-rata berkisar 5mm dan biasanya berwarna hitam atau warna gelap lainnya. Setiap perangkat (device) dihubungkan dengan BNC Tconnector. Kabel jenis ini juga dikenal sebagai thin Ethernet atau ThinNet.
Aturan Kabel Coaxial Kurus
• Setiap ujung kabel diberi terminator 50-ohm.
• Panjang maksimal kabel adalah 1,000 feet (185 meter) per segment.
• Setiap segment maksimum terkoneksi sebanyak 30 perangkat
• jaringan (devices).
• Kartu jaringan cukup menggunakan transceiver yang onboard, tidak perlu tambahan transceiver, kecuali untuk repeater.
• Maksimum ada 3 segment terhubung satu sama lain (populated segment).
• Setiap segment sebaiknya dilengkapi dengan satu ground.
• Panjang minimum antar TConnector adalah 1,5 feet (0.5 meter).
• Maksimum panjang kabel dalam satu segment adalah 1,818 feet (555 meter).

Fiber Optic
Jaringan yang menggunakan Fiber Optic (FO) biasanya perusahaan besar, dikarenakan harga dan proses pemasangannya lebih sulit. Namun demikian, jaringan yang menggunakan FO dari segi kehandalan dan kecepatan tidak diragukan. Kecepatan pengiriman data dengan media FO lebih dari 100Mbps dan bebas pengaruh lingkungan.

Twisted Pair
Kabel Twisted Pair ini terbagi menjadi dua jenis yaitu shielded twisted pair (STP) dan unshielded twisted pair (UTP). STP adalah jenis kabel yang memiliki selubung pembungkus sedangkan UTP tidak mempunyai selubung pembungkus. Untuk koneksinya kabel jenis ini menggunakan konektor RJ-11 atau RJ-45.

Pada twisted pair (10 BaseT) network, komputer disusun membentuk suatu pola Star. Setiap PC memiliki satu kabel twisted pair yang tersentral pada HUB. Twisted pair umumnya lebih handal (reliable) dibandingkan dengan thin coax, karena HUB mempunyai kemampuan data error correction dan meningkatkan kecepatan transmisi. Saat ini ada beberapa grade atau kategori dari kabel twisted pair.

Pemberian kategori 1/2/3/4/5/6 merupakan kategori spesifikasi untuk masing-masing kabel tembaga dan juga untuk jack. Masing-masing merupakan seri revisi atas kualitas kabel, kualitas pembungkusan kabel (isolator) dan juga untuk kualitas “belitan” (twist) masing-masing pasang kabel. Selain itu juga untuk menentukan besaran frekuensi yang bisa lewat pada sarana kabel tersebut, dan juga kualitas isolator sehingga bisa mengurangi efek induksi antar kabel (noise bisa ditekan sedemikian rupa). Perlu diperhatikan juga, spesifikasi antara CAT5 dan CAT5 enchanced mempunyai standar industri yang sama, namun pada CAT5e sudah dilengkapi dengan insulator untuk mengurangi efek induksi atau electromagnetic interference. Kabel CAT5e bisa digunakan untuk menghubungkan network hingga kecepatan 1Gbps.

UTP Cable (CAT5 / CAT5e)
Kategori 5 atau 5e adalah yang paling reliable dan memiliki kompabilitas yang tinggi, dan yang paling disarankan, baik pada 10 Mbps dan Fast Ethernet (100Mbps). Konector yang bisa digunakan untuk UTP Cable CAT5 adalah RJ-45. Untuk penggunaan koneksi komputer, dikenal 2 buah tipe penyambungan kabel UTP ini, yaitu straight cable dan crossover cable. Fungsi masing-masing jenis koneksi ini berbeda, straight cable digunakan untuk menghubungkan client ke HUB/Router, sedangkan crossover cable digunakan untuk menghubungkan client ke client atau dalam kasus tertentu digunakan untuk menghubungkan HUB ke HUB.

Straight Cable
Menghubungkan ujung satu dengan ujung lain dengan satu warna. Sebenarnya urutan warna dari masing-masing kabel tidak menjadi masalah, namun ada standard secara internasional yang digunakan untuk straight cable ini

Walaupun secara fisik hardware telah dipasang (komputer dan NIC, pengkabelan, konektor, dan HUB, dll), tapi jaringan komputer belum dapat difungsikan. Karena setiap device yang dipasang butuh driver yang harus diinstal dan perlu dikonfigurasikan terlebih dahulu. Dalam modul ini akan dibahas instalasi dan konfigurasi jaringan dengan sistem operasi windows.
Selanjutnya akan dilakukan pengujian apakah komputer telah terhubung dengan benar, dan bisa berhubungan dengan jaringan lokal (LAN).

Uji Konektivitas
Setelah proses instalasi dan konfigurasi sistem jaringan (baik hardware maupun software) selesai, maka perlu dilakukan test/uji. Hal ini dimaksudkan untuk melihat apakah instalasi (mulai dari memasang kabel sampai dengan konfigurasi sistem secara software) telah dilakukan dengan benar.
Untuk mengetest TCP/IP, salah satu caranya dapat dilakukan dengan instruksi ipconfig yang dijalankan under DOS.

Perintah IPConfig digunakan untuk melihat indikasi pada konfigurasi IP yang terpasang pada Komputer kita. dari gambar diatas kita dapat melihat beberapa informasi penting setelah kita menjalankan perintah IPConfig pada jendela command prompt di komputer kita, misalnya adalah kita bisa melihat Host Name, primary DNS jaringan, physical Address dan sebagainya. Harus diingat bahwa perintah ini dapat dijalankan dengan baik apabila telah terpasang Network Card di komputer anda. Ipconfig menampilkan informasi berdasarkan Network Card yang terpasang.

Untuk mendeteksi apakah hubungan komputer dengan jaringan sudah berjalan dengan baik, utilitas ping dapat digunakan.
Utilitas ping digunakan untuk mengecek apakah jaringan kita sudah bisa berfungsi dan terhubung dengan baik, misalkan pada gambar diatas terlihat perintah ping LocalHost, jika kita melihat ada keluar pesan Replay form No IP ( ) besarnya berapa bites dan waktunya berapa detik itu menandakan bahwa perintah untuk menghubungkan ke LocalHost dapat berjalan dan diterima dengan baik, namun seandainya jika kita melakukan ping untuk nomor IP yang tidak dikenal seperti gambar 20 diatas maka akan dikeluarkan pesan Request Time Out yang berarti nomor IP tidak dikenal dalam jaringan tersebut (ping
Misalkan telah men-setup 2 buah terminal dengan alamat IP dan, anda dapat melakukan test ping di mode dos dengan mengetik “PING″ dari terminal dengan IP address dan anda akan mendapatkan respon seperti:
Pinging with 32 bytes of data:
Reply from bytes=32 time<10ms TTL=32
Reply from bytes=32 time<10ms TTL=32
Reply from bytes=32 time<10ms TTL=32
Reply from bytes=32 time<10ms TTL=32

Jika mendapatkan respon seperti diatas, maka koneksi jaringan sudah benar. Respon lain selain contoh diatas diartikan bahwa jaringan anda belum bekerja dengan benar. Kesalahan dapat saja terjadi di sistem pengkabelan, kartu jaringan, atau setup network.
Catatan : TTL adalah Time To Live, yaitu batasan waktu agar paket data tersebut tidak mengambang dijaringan.

Pemasangan NIC
• Pemasangan Kartu jaringan pada motherboar disesuaikan dengan kartu jaringan yang dimiliki apakah menggunakan model ISA atau PCI. Kartu jaringan model ISA tidak dapat dipasangkan pada slot PCI dan sebaliknya. Jadi pemasangan kartu jaringan harus sesuai dengan slot ekspansinya. Karena ukuran slot ekspansi yang tidak sama maka mempermudah dalam pemasangan sehingga tidak mungkin tertukar. Pemasangan kartu jaringan dapat dilakukan pada slot manapun selama slot tersebut tidak dipakai oleh komponen lain atau masih kosong.
Karena apabila anda memindah komponen yang sudah ada maka saat menghidupkan komputer windows akan mendeteksi ulang pada seluruh komponen sehingga akan melakukan inisialisasi ulang ini terjadi pada windows 98, Windows 2000 dan windows XP.

Pemasangan UTP > Konektor
Pemasangan Kabel UTP dan Konektor RJ 45 untuk jaringan susunan kabel harus dilakukan standarisasi dengan tujuan untuk mempermudah dalam penambahan jaringan baru tanpa harus melihat susunan yang dipakai jika telah menggunakan standarisasi pengurutan kabel UTP ke konektor RJ 45.

Kabel Lurus (Straight Cable)
Kabel lurus (Straight Cable) adalah sistem pengkabelan antara ujung satu dengan yang lainnya adalah sama. Kabel lurus (Straight Cable) digunakan untuk menghubungkan antar workstation (Client) dengan Hub/Switch.

Kabel Silang (Crossover Cable)
Kabel Silang (Crossover Cable) adalah sistem pengkabelan antara ujung satu dengan yang lainnya saling disilangkan antar pengiriman (Transmiter) data dan penerima (Resiver) data. Kabel pengiriman data ujung satu akan diterima oleh penerima data pada ujung kedua begitupula sebaliknya penerima data satu merupakan pengirim data ujung kedua. Kabel Silang (Crossover Cable) digunakan untuk menghubungkan Hub/Switch dengan Hub/Switch atau antar dua komputer tanpa menggunakan hub.

Pemasangan Kabel UTP dengan konektor RJ 45 pada Topologi Star adalah setiap node akan menuju node pusat/ sentral sebagai konselor. Aliran data akan menuju node pusat baru menuju ke node tujuan. Topologi ini banyak digunakan di berbagai tempat karena memudahankan untuk menambah, megurangi atau mendeteksi kerusakan jaringan yang ada.
Gambaran pemasangan kabel UTP dengan konektor RJ 45 pada Topologi Star adalah sebagai berikut:

Pengisian IP Address & Subnet Mask
IP Address merupakan alamat komputer yang unik dalam sistem jaringan. Karena dalam sistem jarigan yang dituju adalah IP Address sehingga jika terjadi IP Address yang sama maka kedua komputer cross penggunaan alamat yang sama.
Setiap alamat IP terdiri dari dua field, yaitu:
· Field NetId; alamat jaringan logika dari subnet dimana komputer dihubungkan
· Field HostId; alamat device logical secara khusus digunakan untuk mengenali masing-masing host pada subnet.

Kelas A
Oktet pertamanya mempunyai nilai 0 sampai 127, dan pengalamatan Kelas A masing-masing dapat mendukung 16.77.214 host.
Kelas A hanya menggunakan octet pertama ID jaringan, tiga
octet yang tersisa disediakan untuk digunakan sebagai HostId.
Karakteristik Kelas A:
• Bit pertama : 0
• panjang NetlD : 8 bit
• Panjang HostlD : 24 bit
• Byte pertama : 0-127
• Jumlah : 126 kelas A (0 dan 127 dicadangkan)
• Range IP : 1.xxx.xxx.xxx sampai dengan 126.xxx.xxx.xxx
• Jumlah IP : 16.777.214 IP Address pada tiap kelas A

Kelas B
Oktet pertamanya mempunyai nilai 128 sampai 191, dan pengalamatan Kelas B masing-masing dapat mendukung 65.532 host.
Karakteristik Kelas B:
• 2 Bit pertama : 10
• panjang NetlD : 16 bit
• Panjang HostlD : 16 bit
• Byte pertama : 128-191
• Jumlah : 16.384 kelas B
• Range IP : 128.xxx.xxx sampai dengan 191.155.xxx.xxx
• Jumlah IP : 65.532. IP Address pada tiap kelas B

Kelas C
Oktet pertamanya mempunyai nilai 192 sampai 223, dan pengalamatan Kelas B masing-masing dapat mendukung 256 host.
IP Addrress Kelas C sering digunakan jaringan berskala kecil.
Karakteristik Kelas C:
• 3 Bit pertama : 110
• Panjang NetlD : 24 bit
• Panjang HostlD : 8 bit
• Byte pertama : 192-223
• Jumlah : 256 kelas B
• Range IP : 192.0.0.xxx sampai dengan 223.255.255.xxx
• Jumlah IP : 254 IP Address pada tiap kelas C

Nilai subnetmask untuk memisahkan network id dengan host id. Subnetmask diperlukan oleh TCP/IP untuk menentukan apakah jaringan yang dimaksud adalah jaringan local atau non local.
Network ID dan host ID di dalam IP address dibedakan oleh penggunaan subnet mask. Masing-masing subnet mask merupakan pola nomor 32-bit yang merupakan bit groups dari semua (1) yang menunjukkan network ID dan semua nol (0) menunjukkan host ID dari porsi IP address.

Sistem operasi merupakan penghubung antara pengguna komputer dengan perangkat keras komputer. Pengertian sistem operasi secara umum adalah suatu pengelola seluruh sumber-daya yang terdapat pada sistem komputer dan menyediakan sekumpulan layanan ke pemakai sehingga memudahkan penggunaan dan pemanfaatan sumber daya sistem komputer.
Sistem operasi jaringan atau sistem operasi komputer yang dipakai sebagai server dalam jaringan komputer hampir mirip dengan sistem operasi komputer stand alone, bedanya hanya pada sistem operasi jaringan, salah satu komputer harus bertindak sebagai server bagi komputer lainnya. Sistem operasi dalam jaringan disamping berfungsi untuk mengelola sumber daya dirinya sendiri juga untuk mengelola sumber daya komputer lain yang tergabung dalam jaringan.
Sistem operasi harus diinstal ke dalam komputer agar dapat berfungsi dengan baik. Dalam instalasi sistem operasi jaringan terdapat beberapa mode pilihan yang disediakan yaitu berupa mode text dan mode grafik. Instalasi sistem operasi berbasis text merupakan salah satu mode instalasi sistem operasi komputer dengan tampilan text. Mode text digunakan jika spesifikasi hardware komputer yang akan diinstal mempunyai spesifikasi yang rendah. Metode instalasi berbasis text akan mempercepat proses instalasi walaupun dengan tampilan yang kurang menarik dibandingkan dengan mode Grafis (GUI).
Metode instalasi sistem operasi berbasis GUI, mempunyai tampilan grafis yang lebih menarik dan memudahkan dalam proses instalasi sehingga sering dipilih oleh pemakai sistem operasi. Dengan perkembangan hardware komputer yang semakin baik menjadikan faktor kecepatan tidak menjadi kendala dalam proses instalasi.
Sistem operasi komputer telah mengalami perkembangan yang sangat pesat baik untuk keperluan stand alone maupun jaringan. Ada banyak sistem operasi komputer yang dapat digunakan dalam sebuah komputer baik stand alone maupun jaringan diantaranya adalah Microsoft Windows Series (Win 3.1, Win 9x, Win ME, Win 2000, Win XP, Win NT), Unix, San Solaris, Linux Series (Redhat, Debian, SUSE, Mandrake, Knoppix), Mac, dan lain sebagainya. Masing-masing sistem operasi memiliki kelebihan dan kekurangan sehingga diperlukan analisis dalam memilih sistem operasi mana yang sesuai dengan kebutuhan.

• Seperti pada sistem operasi yang dapat digunakan pada PC, sistem operasi jaringan juga bermacam-macam. Banyak perusahaan yang mengembangkan sistem operasi jaringan dari yang komersial sampai dengan sistem operasi yang bersifat free alias gratis. Sistem operasi memegang peranan yang sangat vital terhadap program yang akan berjalan. Pemilihan sistem operasi harus disesuaikan dengan kebutuhan baik hardware, program yang akan dipakai maupun user yang akan memakai sistem.
Microsoft Windows NT, Windows 2000 Server danWindows 2003 Server merupakansistemoperasijaringanyang dikembangkanolehperusahaanMicrosoft denganlisensikomersial. UntukmenggunakansistemoperasijaringandariMicrosoft kitaharusmembayarlisensiataumembelisesuaidengankebutuhandankesepakatanantarapenggunadenganperusahaan.

SelainMicrosoft perusahaanyang mengembangkansistemoperasijaringanadalahUnix, San Solaris danperusahaanlainnya. Salahsatusistemoperasijaringanyang dikembangkansecaradenganfree adalahLinux. Linux dikembangkanpertamakali olehLinusTorvalds, mengusungproyekopen source denganlisensiGNU/GPL (General Public Licence) yaitusuatulisensidimanapemilikprogram tetapmemeganghaknyatetapioranglain dimungkinkanuntukmenyebarkan, memodifikasi, ataubahkanmenjualkembaliprogram tersebuttetapidengansyaratsource code aslidanhakciptaharusdiikutsertakandalamdistribusinya. Dengankonsepinisemuaorangdapatikutmengembangkansistemoperasidansoftware berbasislinux.

Dengan lisensi GNU/GPL Linux menjadi salah satu sistem operasi yang mengalami perkembangan yang sangat cepat, karena Linux dikembangkan oleh komunitas pengguna sistem operasi open source.
Kelemahan sistem operasi atau yang sering disebut dengan “Bug” akan segera diperbaiki oleh komunitas pengguna linux dan dapat langsung didistribusikan dengan free. Dengan demikian sistem operasi Linux menjadi sistem operasi yang up to date setiap saat.

Mungkin anda masih bingung dengan Lisensi GNU/GPL, kalau demikian perusahaan atau orang yang mengembangkan Linux dari mana mendapat keuntungan?. Yang dimaksud dengan GNU/GPL disini adalah bahwa sistem operasi yang dikembangkan memang bersifat free tetapi pengembang dapat juga menjualnya dengan harga yang tidak terlalu mahal dan perusahaan dapat memperoleh keuntungan dari jasa pelayanan instalasi, pelatihan, implementasi sistem dan lain sebagainya.


Tinggalkan Balasan

Isikan data di bawah atau klik salah satu ikon untuk log in:

Logo WordPress.com

You are commenting using your WordPress.com account. Logout /  Ubah )

Foto Google+

You are commenting using your Google+ account. Logout /  Ubah )

Gambar Twitter

You are commenting using your Twitter account. Logout /  Ubah )

Foto Facebook

You are commenting using your Facebook account. Logout /  Ubah )


Connecting to %s