Jaringan Komputer : Bab 11

Pengenalan OSI dan ISDN

ISDN
 LayananJaringanDigital Terintegrasi.
 Suatupelayanantelepondigital yang menyediakantransmisidata akuratcepatmelaluitelepon.
 Cara cepatuntukonline.
 Jaringandigitalyangmemberikanberbagaimacampelayananjasatelekomunikasiyangberlakudiseluruhdunia.ISDNadalahmerupakantransisisistemteleponduniadariteknologianalogkedigitaluntukmemungkinkantransmisigabungandarisemuadansetiapinormasi,mencakupsuara,gambar,suratkabar,diagram,danbahkanvideoconferencing,merupakankonseptahun1970anyangdiciptakandiEropa

Infrastruktur ISDN
• TeknologijaringaninidiprakarsaiolehH.ShimadapadasuatupertemuanCCITTtahun1971.Kemudian,aplikasiISDNsegeraterwujudsetelahCCITTmerekomendasikanstandarRedBook(1985)danstandarBlueBook(1988)dalamwujudNarrowBand(N-ISDN). ISDNdikembangkandarijaringantelepondenganmengusahakanagartidakmelakukanperubahansecaramendasarpadasentralteleponyang sudahada.
• ITUadalahsuatuOrganisasiPerserikatanBangsa-Bangsayangmengkoordinirdanmenstandardisasitelekomunikasiinternasional.RekomendasiISDNasliadalahdalamRekomendasiCCITTI.120(1984)yangmanadiuraikanpetunjukawalbeberapauntukmenerapkanISDN.

Tranmisi ISDN
• StrukturTransmisi
“Digital pipe“ antaraCentral danuser ISDN dapatdigunakanuntukmembawasejumlahkanalkomunikasi.Kapasitas(jumlah) kanalyang dapatdibawabervariasiantarasatuuser denganuser lainnya. Strukturtransmisidarisemuaakseslink dapatdibentukdaribeberapatipekanal, yaitu:
KanalB : 64 kbps
KanalD : 16 atau64 kbps
KanalH : 384, 1536 dan1920 kbps

B-Channel
• [Bearier](“B”)saluranadalahsuatu64kbpsmenggaliyangdapatdigunakanuntuksuara,video,data,ataupanggilanmultimedia.B-Channelsdapatdigunakanbersama-samabahkanuntukaplikasiluasbidanglebihtinggi.
• KanalBadalahkanaldasar,dapatdigunakanuntukmembawadatadigital,PCM-encodeddigitalvoice,ataucampuran.
• Tigajeniskoneksidapatdilakukanpadakanalini,yaitu:
1.Circuit-switched
Koneksiiniekivalendenganpelayananswitcheddigitalyangtersediasaatini.
2.PemakaiterhubungkepacketswitchingnodedandatadipertukarkandenganuserlainnyamenggunakanX.25.
3.Semipermanent
Sistemkoneksiiniekivalendenganleasedline.

D-Channel
• Delta(“D”)saluranyangdapatdigunakanbaik16kbpsmaupun64kbpsterutamauntukkomunikasi(atau”signaling”)antaramenswitchperalatandidalamjaringanISDNdanperalatanISDN.
• KanalDmenyediakanduafungsi,pertamauntuksignalling&controlling,dankeduadapatdipakaiuntukpacket-switchingataulow-speeddatatelemetrypadasaattidakadainformasisignallingyangsedangditunggu.SedangkankanalHdisediakanuntukpemakaidenganbitrateyangtinggi.

LayananISDN
• Basic Rate Interface (BRI) .BRI adalahlayananISDN yang umum digunakan hubungan ke internet. SuatuISDN BRI koneksimendukungdua64 kbps B-Channels dansatu16 kbps D-Channel diatasjalurteleponstandard.
• BRI dikenal dengan istilah” 2B+D” mengacupadaduaB-Channels dansatuD-Channel. D-Channel diatassuatujalurBRI dapatmendukungkecepatanrendah( 9.6 kbps) X.25 Data, tetapiinibukanlahaplikasiyang sangatpopulerAmerikaSerikat.

Primary Rate Interface (PRI).
• PrimaryRateInterface(PRI).LayananISDNPRIterutamadigunakanolehorganisasibesaryangmemerlukankomunikasiintensive.
• SuatukoneksiISDNPRImendukung2364kbpsB-Channelsdansatu64kbpsD-Channel(atau23B+D)diatassuatusirkuitkecepatantinggiDS1(atauT-1).
• BentukPRIdiEropasedikitberbeda,menggunakan30B+D.

Jenis PRI
• AdaduajenisPRI :
• Terdiriatas23 kanalB 64 kbps dansatukanalD 64 kbps dengantotal bit rate 1,544 Mbps (digunakandiAmerikaUtara danJepang)
• Terdiriatas30 kanalB 64 kbps dansatukanalD 64 kbps dengantotal bit rate 2,048 Mbps (digunakandiEropa, Australia dll).
• Primary Rate interface jugadigunakanuntukmendukungkanalH. Beberapastrukturyang dikenaladalah:
• Primary Rate Interface H0 channel structures
• Terdiriatas3 kanalH0 384 kbps + 1 kanalD 64 kbps atau4 kanalH0 untukmem-bentukinterface 1,544 Mbps, atau5 kanalH0 + satukanalD untukmembentukinterface 2,048 Mbps.
• Primary Rate Interface H1 channel structures
• TerdiriatassatukanalH11 1536 kbps atau1 kanalH12 1920 kbps + 1 kanalD.
• Primary Rate interface structure for mixture of B and H0 channels
• TerdiridarisatuataunolkanalD danbeberapakemungkinankombinasidarikanalB dankanalH0 (misal: 3H0 + 5B + D atau3H0 + 6 B).

ISDN Layer 1
• ISDN lapisanfisik( Lapisan1) format frame berbedatergantungpadaapakahframe adalahperjalanankeluar( dariterminal kejaringan) ataudalamperjalanankedalam( darijaringanketerminal). Keduaalatpenghubunglapisanfisikditunjukkan
• Frame mempunyaipanjang48 bit, yang mana36 bit membawadata. Bit darisuatulapisanfisikISDN digunakansebagaiberikut:
F—Provides synchronization
L—Adjusts the average bit value
E—Ensures contention resolution when several terminals on a passive bus contend for a channel
A—Activates devices
S—Is unassigned

ISDN Physical Layer
• BerbagaiISDN user devices dapatsecarafisikdihubungkandengansatusirkuit. Dalam) bentukwujudini, benturandapatterjadijikaduaterminal memancarkansecaraserempak. Olehkarenaitu, ISDN menyediakanfeature untukmenentukanlink contention. KetikasuatuNT menerimasuatuD bit dariTE, halitumenggemakembalibit itukedalamposisiE-Bit yang berikutnya. TE mengharapkanE bit yang berikutnyasamasepertiD bit yang terakhirdipancarkan.
• Terminal tidakbisamemancarkankedalamD channel kecualijikamerekapertamamendeteksisuatuangkaspesifikdariones ( menandakan” tidakadasignal”) sesuaidengansuatuprioritaspre-established. JikaTE mendeteksibit didalamgemaE channel ituberbedadarinyaD bits, transmisiharusberhentiseketika. Teknikyang sederhanainimemastikanbahwahanyasatuterminal dapatmemancarkanpesanD padasatuwaktu. SetelahD-Message suksesditransmisi, prioritasterminal dikurangidenganmendeteksi1 pesanberikutnyasebelumtransmisi. Terminal tidakbisamenaikkanprioritasnyasampaisemuadevice yang lain padaline yang samapastimempunyaisuatukesempatanuntukmengirimkansuatuD message. Sambunganteleponmempunyaiprioritaslebihtinggidibandingsemualayananyang lain , dansignallinginformasimempunyaisuatuprioritaslebihtinggidibandingnonsignalinginformasi.

Layer 2
• Lapisan2dariprotokolsignallingISDNprotokoladalahLinkAccessProcedure,Dchannel(LAPD).LAPDadalahmiripHigh-LevelDataLinkControl(HDLC)danLinkAccessProcedure,Balanced(LAPB).KetikaperluasandariakronimLAPDdiketahui,lapisaninidigunakankeseberangchannelDuntukmemastikanbahwakendalidansignallingarusinformasidanditerimadenganbaik.FormatframeLAPD-3)sangatserupadenganHDLC;sepertiHDLC,LAPDmenggunakansupervisory,information,andunnumberedframes.LAPDprotokolsecaraformalditetapkandalamITU-TQ.920DanITU-TQ.921.
•Field LAPD Flag danControl adalahserupadenganHDLC. LAPD Address field panjangnyadapat1 maupun2 bytes. Jikaalamatbit yang diperluasdaribyte pertamadi-set, alamatadalah1 byte; jikatidakdi-set, alamatadalah2 bytes. Address-Field yang pertamabyte berisiservice access point identifier( SAPI), yang mengidentifikasipintugerbangdimanalayananLAPD disediakankeLapisan3. C/R Bit menandaiapakahframe berisisuatuperintahatausuaturespon. Field Terminal Endpoint Identifier ( TEI) mengidentifikasibaikterminal tunggalmaupunmultiple terminal.

Layer 3
• Duaspesifikasilayer 3 yang digunakanuntuksignallingISDN : ITU-T I.450( dahuluCCITT) ( jugadikenalsebagaiITU-T Q.930) danITU-T I.451 ( jugadikenalsebagaiITU-T Q.931). Secarabersama-sama, protokolinimendukunguser-to-user, circuit-switched, dankoneksipacket-switched. Berbagaicall-establishment, call-termination, informasi, danbermacam-macampesandispesifikasikan, mencakupSETUP, CONNECT, RELEASE, INFORMASI PEMAKAI, CANCEL, STATUS, danDISCONNECT. Pesaninisecarafungsionalmirippesanyang disediakanolehProtokolX.25 . Gambar12-4, dariITU-T I.451, menunjukkanlangkah-langkahyang khasdarisuatupanggilanISDN circuit-switched.

Iklan

Jaringan Komputer : Bab 10

Memahami Konsep dan Komunikasi data dalam teknologi Jaringan Komputer

 

> Memahami cara pengiriman komunikasi data dalam WAN, konsep relay
•Bahan Kajian

>Konsep dan komunikasi data dalam WAN

WAN

• WAN(WideAreaNetwork)yaitujaringankomputerdenganjarakjauhyangmeliputidaerah,negerimaupunnegara.DalamWANbiasanyatransmisidatatidakbegitucepatkarenamembutuhkanbiayayangsangattinggiuntukkecepatantransmisidatayangtinggi(sepertipemakaiankabelseratoptik).

dialed circuit
• Pembangunanrangkaianbiasanyaakanmenggunakanmediakomunikasiyangtelahdisediakanolehpenyediakomunikasidata(commoncarrier)yangbiasanyaolehnegarasepertiTELKOM.Dalampemakaianmediainidapatdikategorikanatas4,yaitu:
• jalurdialup(dialedcircuit),carainibiasanyamenggunakanjaringanteleponPSTN(PublicServiceTelephoneNetwork).Mediainimengandungbanyakkerusakandata(noise)danrendahkadarkecepatandalampenghantarandata.BiayayangdikeluarkantergantunglamawaktupemakaianmediadanuntukpenyambungnyamenggunakanMODEM.

dedicated circuit
• jalurtetap(dedicatedcircuit),yaitumeggunakanjaluryangsudahdisewatersendiriolehpemakaimediapadapenyediajasakomunikasi(TELKOM).Caraberkomunikasiadalahpoint-to-point.Biayayangdikeluarkanuntukmenyewajalurinibiasanyaperbulan,tergantungdarijenisjaluryangdisewa(analog,digitalatausatelit)danbesar‘bandwidthnya’

switched circuit
• jalurswitch(switchedcircuit),carainihambirsamadenganjalurdialuptetapilebihdikhususuntukpenghantarandata.Biayanyatergantungterhadapwaktupemakaianmediadanjumlahdatayangmelewatimediatersebut.

packet switched
• jalurpaketswitch(packetswitched),carainihampirsamadenganswitchedcircuittetapicarapenghantarandatanyaberbeda.Datayangakandihantar,dipecahkedalampaketataubingkisan(packet)tetapibisasajasetiappaket-pakettersebutdihantarmelaluijalurataujalanyangberbeda.Biayayangdikeluarkanuntukkomunikasibiasanyatergantungkepadajumlahpaketataubingkisanyangdihantar

Jaringan Switch
• Kelemahanutamasistemdialadalah’noise’dankadarenghantarandatanyayanglambatdankelemahanpadajalurtetapadalahbiayanyaadalahtetap(walaupunpemakaiannyasedikitataujarangdigunakan)danberbentuk’point-to-point.SehinggarangkaianJalurSwitchmemberikanalternatifterhadapkelemahandiatas.Rangkaianinisangatcocokuntukmenghantardata,lebihcepat(laju)darijalurdialdankurangnoise.Biayayangdikenakanhanyaapabilamenggunakanrangkaiansajadanjaluryangdipakaiketujuanmengambilsambunganatausimpul(node)yangterdekatsaja.SehinggabilakomunikasihendakdilakukandenganjalurSwitch,jalanyangakandilaluiditentukanterlebihdahulu.Setelahjalanyangbakaldilaluitelahditentukan,makakesemuadatayanghendakdihantarakanmelaluijalanyangsama.Jenisrangkaianyangadadalamkategoriiniadalah:

>ISDN (Integrated Services Digital Network),
>SMDS (Switched Multimegabit Data Service),
>B-ISDN (Broadband -ISDN) dan yang disediakan oleh Telkom disebut dengan JAMUS

ISDN
• ISDN(IntegratedServicesDigitalNetwork)adalahsuatusistemtelekomunikasidimanalayananantaradata,suara,dangambardiintegrasikankedalamsuatujaringan,yangmenyediakankonektivitasdigitalujungkeujunguntukmenunjangsuaturuanglingkuppelayananyangluas.ParapemakaiISDNdiberikankeuntunganberupafleksibilitasdanpenghematanbiaya,karenabiayauntuksistemyangterintegrasiiniakanjauhlebihmurahapabilamenggunakansistemyangterpisah.ISDNdisebutsebagaiteknologicircuit-switching.Panggilanbergerakdariswitchuntuksampaiditujuanakhir.Setelahituada,jalursirkuitdibukadarisalahsatuujungpanggilanyanglain. Sirkuityangtetapterbukasampaiditutupolehsalahsatupihakyangberpartisipasi

Operasi ISDN
• Dalam Gambar, ketika K ingin terhubung C dia harus menghubungi nomor yang telah dikaitkan dengan sirkuit ISDN C. Angka-angka biasanya disebut sebagai nomor telepon, tetapi di dunia ISDN mereka sebenarnya E.164 angka, atau alamat. Ketika panggilan K 555-1212, diaktifkan melalui jaringan ke lokasi C dan panggilan tersambung. Panggilan transit melalui public switched jaringan telepon (PSTN). Jalur sirkuit antara kedua pihak dicadangkan untuk durasi panggilan . Salah satu masalah dengan struktur jaringan seperti ini adalah bahwa mereka bisa sangat tidak efisien.Sambungan mungkin tidak membutuhkan semua bandwidth yang dialokasikan

SEJARAH ISDN
Sebelum terciptanya ISDN, ada juga beberapa jaringan konvensional yang digunakan dalam masyarakat, yaitu:
Jaringan Telepon (PSTN = Public Switched Telephone Network)
Jaringan komunikasi data (PDN = Public Data Network)
Jaringan Telex (PSTX)
Jaringan-jaringan konvensional inidigabungkanmenjadijaringandigitalyangterintegrasidengancaramendigitalisasijaringankonvensionaltersebut,kemudianjaringan-jaringanyangtelahmemenuhikonsepIntegratedDigitalNetworkdiintegrasikansehinggapadaakhirnyakitadapatmengintegrasikansemuajaringanonvensionalinimenjadisebuahjaringanterpaduyangmemilikikonsepdigitalsampaikepenggunaakhir.Melihatlangkah-langkahpenggabungandiatas,dapatdisimpulkanbahwaIDNmerupakanasalmulaterciptanyaISDN.Awalnya,teleponjaringanmenggunakankawatataukabeluntuksaranakoneksinya.

Layanan ISDN
Ada beberapa fitur layanan utama yang ditawarkan oleh sistem ISDN. Yaitu:
• Bearer Service.
BearerServicemerupakanlayananawaldandasaryangdiperuntukkanbagipenggunayangbarubergabungdenganjaringanISDN.PenggunabaruakanmendapatkanlayanandasarinibegitumendaftarsebagaipelangganISDN.BearerServicemenyediakanlayanantransfermode,transferrate,dantransfercapability.Layananinimenunjukkandanmenjelaskankarakteristikjaringantransmisiyangditawarkanolehoperatorpenyediajaringanantaraterminalpengguadanjaringan.

• TeleService
TeleServiceadalahlayananyangpadadasaranyatelahdiberikandariawalolehjaringanISDN,namununtukmenggunakannyaharusdidukungdariperalatanatauterminalpengguna.Jikapenggunamasihmenggunakanperalatanstandar,makalayananTeleServiceinitidakdapatdigunakan.

• Supplementary Service
SupplementaryServiceadalahlayanantambahanyangdisediakanolehjaringanISDNkepengguna,namundalammengaksesnya,penggunadibebankanbiayatambahanketikamengaktifkanlayananini.SupplementaryServicedigunakanbersamadenganlayanandasarjaringanISDN.
Aplikasi yang didukung oleh ISDN

•Teledisket
•PC Workgroup
•Inter LAN
•HiQ Fax
•Video Conference
•Remote Security Control
•Bank Account Line
•Teledoctor
•Wide Voice
•Back Up Line

 

SMDS
• SMDSterdiridariseperangkatteknologiyangmemungkinkanuntukkecepatantinggi,connectionless,LAN-to-LANdijaringanMANdanWAN.KonektivitaskejaringanSMDSadalahmemberikanlebihdarilayanandigitaldataphone(DDS),T1/E1,T3/E3ataufasilitaslainnya.SebagaisebuahlayananLANinterconnect,dukunganasliadauntuksemuaprotokoljaringanutama,sepertiTransmissionControlProtocol/InternetProtocol(TCP/IP),InternetworkPacketExchange(IPX),danAppletalk.Selanjutnya,frameSMDScukupbesarberukuranuntukmendukungmulustransportasidariIEEE802.3,802,5,danFiberDistributedDataInterface(FDDI)frametanpafragmentasi.SebagailayananSMDSsecaraekonomimenarik.Karenahargalayanandidasarkanpadakecepatandanjumlahsitus,bukanjarakantarasitus,yangmerupakankasusdenganprivate-line.

Manajemen Jaringan SMDS
• ManajemenjaringandilakukandenganmenggunakanberbasisstandarSimpleNetworkManagementProtocol(SNMP),sehinggamembuatoff-theshelfsistemmanajemenjaringanpilihanyanglayak,daripadaharusmembangunkepemilikansistem.Akhirnya,iadirancanguntukmenyediakanintegrasidengandanakhirnyatransisikeAsynchronousTransferMode(ATM).Intinya,namalayananmerangkumkeseluruhanfitur

Frame Relay
• Frame Relay is an InternationalTelecommunication UnionTelecommunications Standardization Sector (ITU-T) and American National Standards Institute (ANSI) standard. Frame Relay is a packet-switched, connection-oriented, WAN service. It operates at the data link layer of the OSI reference model.

•Frames carry data between user devices called data terminal equipment (DTE), and the data communications equipment (DCE) at the edge of the WAN.

• A Frame Relay network may be privately owned, but it is more commonly provided as a service by a public carrier. It typically consists of many geographically scattered Frame Relay switches interconnected by trunk lines.

• Frame Relay is often used to interconnect LANs. When this is the case, a router on each LAN will be the DTE. A serial connection, such as a T1/E1 leased line, will connect the router to a Frame Relay switch of the carrier at the nearest point-of-presence for the carrier. The Frame Relay switch is a DCE device. Frames from one DTE will be moved across the network and delivered to other DTEs by way of DCEs.

•The connection through the Frame Relay network between two DTEs is called a virtual circuit (VC). Virtual circuits may be established dynamically by sending signaling messages to the network. In this case they are called switched virtual circuits (SVCs). However, SVCs are not very common. Generally permanent virtual circuits (PVCs) that have been preconfigured by the carrier are used. The switching information for a VC is stored in the memory of the switch.

• Because it was designed to operate on high-quality digital lines, Frame Relay provides no error recovery mechanism. If there is an error in a frame it is discarded without notification.

• The various virtual circuits on a single access line can be distinguished because each VC has its own Data Link Channel Identifier (DLCI). The DLCI is stored in the address field of every frame transmitted. The DLCI usually has only local significance and may be different at each end of a VC.

Jaringan Komputer : Bab 9

Network address dan network service

Misi awal Internet adalah sebagai jaringan komunikasi non-profit. Pada awalnya, Internet di desain tanpa memperhatikan dunia bisnis. Kemudian hal ini menjadi masalah sekarang dan dimasa depan. Dengan semakin banyaknya penghuni Internet, baik pencari informasi mau pun penyedia informasi, maka kebutuhan akan pengalamatan diInternet makin membengkak. Kebutuhan besarakan IP address biasanya terjadi dijaringan komputer perusahaan dan LAN-LAN dilembaga pendidikan.

IP address sebagai sarana pengalamatan di Internet semakin menjadi barang mewah dan ekslusif. Tidak sembarang orang sekarang ini bisa mendapatkan IP address yang valid dengan mudah. Oleh karena itu lah dibutuhkan suatu mekanisme yang dapat menghemat IP address. Logika sederhana untuk penghematan IP address ialah dengan mengshare suatu nomor IP address valid kebeberapa client IP lainnya. Atau dengan kata lain beberapa komputer bisa mengakses Internet walau kita hanya memiliki satu IP address yang valid. Salah satu Mekanisme itu disediakan oleh Network Address Translation (NAT)

Konsep
• Protokol yang menjadi standar dan dipakai hampir oleh seluruh komunitas Internet adalah TCP/IP (Transmission Control Protocol / Internet Protocol). Agar komputer bisa berkomunikasi dengan komputer lainnya, maka menurut aturan TCP/IP, komputer tersebut harus memiliki suatu address yang unik. Alamat tersebut dinamakan IP address. IP Address memiliki format sbb : aaa.bbb.ccc.ddd.
Contohnya:167.205.19.33

• Untuk berkomunikasi diInternet, komputer harus memiliki IP address yang legal. Legal dalam hal ini artinya adalah bahwa alamat tersebut dikenali oleh semua router didunia dan diketahui bahwa alamat tersebut tidak ada duplikatnya ditempatlain. IP address legal biasanya diperoleh dengan menghubungi Inter NIC.

• Gateway adalah komputer yang memiliki minimal 2 buah network interface untuk menghubungkan 2 buah jaringan atau lebih. Di Internet suatu alamat bisa ditempuh lewat gateway – gateway yang memberikan jalan / rute ke arah mana yang harus dilalui supaya paket data sampai ketujuan.

• Kebanyakan gateway menjalankan routing daemon (program yang mengupdate secara dinamis tabel routing). Karena itu gate way juga biasanya berfungsi sebagai router. Gateway / router bisa berbentuk Router box seperti yang diproduksi Cisco, 3 COM, dll atau bisa juga berupa komputer yang menjalankan Network Operating System plus routing daemon.
Misalkan PC yang dipasang Unix Free BSD dan menjalankan program Routed atau Gated. Namun dalam pemakaian Natd , routing daemon tidak perlu dijalankan, jadi cukup dipasang gateway saja.

FIREWALL

• Karena gateway / router mengatur lalu lintas paket data antar jaringan, maka didalamnya bisa dipasangi mekanisme pembatasan atau pengamanan (filtering) paket – paketdata. Mekanisme ini disebut Firewall

• Firewall adalah suatu program yang dijalankan digateway / router yang bertugas memeriksa setiap paket data yang lewat kemudian membandingkannya dengan rule yang diterapkan dan akhirnya memutuskan apakah pket data tersebut boleh diteruskan atau ditolak. Tujuan dasarnya adalah sebagai security yang melindungi jaringan internal dari ancaman dari luar

NAT

• Network Address Translation (NAT) adalah suatu metode yang mengijinkan client yang tidak mempunyai IP non-routable dapat koneksi ke Internet. Sebuah router yang dikonfigurasi menggunakan NAT paling sedikit mempunyai satu interface untuk koneksi ke Internet dan satu interface juga ke Local Area Network (LAN). Ketika suatu paket meninggalkan LAN, NAT menerjemahkan IP address non-routable menjadi IPaddress yang valid, begitu pula sebaliknya apabila ada paket yang memasuki LAN, NAT akan menerjemahkan IP address valid dan routable menjadi IP address yang non-routable.

Mekanisme NAT
• Sebuah paket TCP terdiri dari header dan data. Header memiliki sejumlah field didalamnya, salah satu field yang penting disini adalah MAC (MediaAccessControl) address asal dan tujuan, IP address asal dan tujuan, dan nomor port asal dan tujuan.

• Saat mesin A menghubungi mesin B, header paket berisi IP A sebagai IP address asal dan IP B sebagai IP address tujuan. Header ini juga berisi nomor port asal (biasanya dipilih oleh mesin pengirim dari sekumpulan nomor port) dan nomor port tujuan yang spesifik, misalnya port80 (untukweb).

•KemudianBmenerimapaketpadaport80danmemilihnomorportbalasanuntukdigunakansebagainomorportasalmenggantikanport80tadi.MesinBlalumembalikIPaddressasal&tujuandannomorportasal&tujuandalamheaderpaket.SehinggakeadaansekarangIPBadalahIPaddressasaldanIPAadalahIPaddresstujuan.KemudianBmengirimpaketitukembalikeA.Selamasessionterbuka,paketdatahilirmudikmenggunakannomorportyangdipilih.

•Router(yangbiasa–tanpaNatd)memodifikasifieldMACaddressasal&tujuandalamheaderketikame-routepaketyangmelewatinya.IPaddress,nomorport,dannomorsequenceasal&tujuantidakdisentuhsamasekali.NATjugabekerjaatasdasarini.DimulaidenganmembuattabeltranslasiinternaluntuksemuaIPaddressjaringaninternalyangmengirimpaketmelewatinya.Lalumen-settabelnomorportyangakandigunakanolehIPaddressyangvalid.KetikapaketdarijaringaninternaldikirimkeNatduntukdisampaikankeluar,Natdmelakukanhal-halsebagaiberikut:
1. MencatatIP addressdanportasaldalamtabeltranslasi
2. MenggantikannomorIP asalpaketdengannomorIP dirinyayang valid
3. Menetapkannomorportkhususuntukpaketyang dikirimkeluar, memasukkannyadalamtabeltranslasidanmenggantikannomorportasaltersebutdengannomorportkhususini.
Contoh

•Ketikapaketbalasandatangkembali,Natdmengeceknomorporttujuannya.Jikainicocokdengannomorportyangkhusustelahditetapkansebelumnya,makadiaakanmelihattabeltranslasidanmencarimesinmanadijaringaninternalyangsesuai.Setelahditemukan,iaakanmenuliskembalinomorportdanIPaddresstujuandenganIPaddressdannomorportasalyangasliyangdigunakanduluuntukmemulaikoneksi.Lalumengirimpaketinikemesindijaringaninternalyangdituju.Natdmemeliharaisitabeltranslasiselamakoneksimasihterbuka.

•HostAmengirimpermintaanrequestwebkehostCyangmempunyaiIPvalid,permintaantersebutkemudianditerimaolehrouter,danroutertersebutkemudianmengecekpadatabelNAT.RouterkemudianmenerjemahkanIPaddresshostA(192.168.1.94)keIPaddressyangvalidyaitu203.102.2.2,danketikaHostBmengirimpermintaanrequestwebkehostC,permintaantersebutkemudianditerimaolehrouterdanroutertersebutkemudianmengecekpadatabelNAT,setelahiturouterkemudianmenerjemahkanIPaddresshostB(192.168.1.95)keIPaddressyangvalidyaitu203.102.2.3,dansebaliknyaketikahostA(192.168.1.94)mengirimkanpacketkehostB(192.168.1.95),routerhanyamemforwardpackettersebuttanpamelakukanpengubahanIPaddressterhadapnya.

•NATmenawarkansolusiyanglebihfleksibeldanscalable.NATmenghilangkankeharusanmengkonfigurasiproxy/sockdalamtiapclient.NATlebihcepatdanmampumenanganitrafiknetworkuntukberibu-ribuusersecarasimultan.

•TranslasialamatyangditerapkandalamNAT,membuatparacrackerdiInternettidakmungkinmenyeranglangsungsistem-sistemdidalamjaringaninternal.IntruderharusmenyerangdanmemperolehakseskemesinNATdulusebelummenyiapkanserangankemesin-mesindijaringaninternal.Pentingdiketahuibahwa,sementaradenganNATjaringaninternalterproteksi,namununtukmasalahsecurity,tetapsajadiperlukanpaketfilteringdanmetodapengamananlainnyadalammesinNAT

Network Service
•Authentication servers
•Directory services
•Dynamic Host Configuration Protocol (DHCP)
•DNS
•e-Mail
•Printing
•Network file system

Outentifikasi
•Sebuahserverotentikasiadalahsebuahaplikasiyangmemfasilitasiotentikasidarisuatuentitasyangmencobamengaksesjaringan..Sebuahserverotentikasidapatberadapadasebuahkomputerkhusus,Ethernetswitch,accesspointatauserveraksesjaringan.Otentikasiadalahprosesuntukmenentukanapakahseseorangmemilikihakuntukmengaksesjaringan,indetifikasiseserangdapataksesumumnyamengggunakanusernamedanpassword.

Directory Service
•Directory Service adalah layanan sebuah perangkat lunak sistem yang menyimpan, mengorganisir dan menyediakan akses ke informasi dalam direktori. Dalam rekayasa perangkat lunak, direktori adalah peta antara nama dan nilai. Hal ini memungkinkan pencarian nilai-nilai diberi nama, mirip dengan kamus.

•Sebagai kata dalam kamus mungkin memiliki beberapa definisi, dalam sebuah direktori, nama mungkin berhubungan dengan beberapa, potongan informasi yang berbeda. Demikian juga, sebagai sebuah kata dapat memiliki bagian yang berbeda berbicara dan definisi yang berbeda, nama dalam direktori mungkin memiliki berbagai jenis data

•Sebuahlayanandirektorimendefinisikannamespaceuntukjaringan.Namespacedalamkonteksiniadalahistilahyangdigunakanuntukmenyimpansatuataulebihobjeksebagaientribernama.Prosesdesaindirektoribiasanyamemilikiseperangkataturanyangmenentukanbagaimanasumberdayajaringandiberinamadandiidentifikasi.Aturanmenetapkanbahwanamamenjadiunikdantidakambigu.DalamX.500(standardirektoriservis)danLDAPnamadisebutnamaDistinguished(DN)dandigunakanuntukmerujukkepadakumpulanatribut(namaygrelatif)yangmembentuknamasebuahentridirektori.

•Sebuahlayanandirektoriadalahinfrastrukturinformasibersamauntukmencari,mengeloladanmengaturitemyangumumpadasumberdayajaringan(volume,folder,file,printer,pengguna,kelompok,perangkat,nomortelepondanobjeklain.

•SebuahlayanandirektoriadalahkomponenpentingdarisebuahNOS(NetworkOperatingSystem).
•DalamkasusyanglebihkomplekslayanandirektoriadalahrepositoripusatinformasiuntukLayananDeliveryPlatform.Misalnya,mencari”komputer”menggunakanlayanandirektorimungkinmenghasilkandaftarkomputeryangtersediadaninformasiuntukmengaksesmereka.

DHCP
•DynamicHostConfigurationProtocoladalahprotokolyangberbasisarsitekturclient/serveryangdipakaiuntukmemudahkanpengalokasianalamatIPdalamsatujaringan.SebuahjaringanlokalyangtidakmenggunakanDHCPharusmemberikanalamatIPkepadasemuakomputersecaramanual.JikaDHCPdipasangdijaringanlokal,makasemuakomputeryangtersambungdijaringanakanmendapatkanalamatIPsecaraotomatisdariserverDHCP.SelainalamatIP,banyakparameterjaringanyangdapatdiberikanolehDHCP,sepertidefaultgatewaydanDNSserver.

•DHCPserverumumnyamemilikisekumpulanalamatyangdiizinkanuntukdidistribusikankepadaklien,yangdisebutsebagaiDHCPPool.SetiapklienkemudianakanmenyewaalamatIPdariDHCPPooliniuntukwaktuyangditentukanolehDHCP,biasanyahinggabeberapahari.ManakalawaktupenyewaanalamatIPtersebuthabismasanya,klienakanmemintakepadaserveruntukmemberikanalamatIPyangbaruataumemperpanjangnya

Cara Kerja DHCP
•DHCP Clientakan mencoba untuk mendapatkan hak menggunakan alamat IP dari sebuah DHCP server dalam proses empat langkah berikut:

•DHCPDISCOVER: DHCP client akan menyebarkan request secara broadcast untuk mencari DHCP Server yang aktif.

•DHCPOFFER: Setelah DHCP Server mendengar broadcast dari DHCP Client, DHCP server kemudian menawarkan sebuah alamat kepada DHCP client.

•DHCPREQUEST: Client meminta DCHP server untuk menyewakan alamat IP dari salah satu alamat yang tersedia dalam DHCP Pool pada DHCP Server yang bersangkutan.

•DHCPACK: DHCP server akan merespons permintaan dari klien dengan mengirimkan paket acknowledgment. Kemudian, DHCP Server akan menetapkan sebuah alamat (dan konfigurasi TCP/IP lainnya) kepada klien, dan memperbarui basis data database miliknya. Klien selanjutnya akan memulai proses bindingdengan tumpukan protokol TCP/IP dan karena telah memiliki alamat IP, klien pun dapat memulai komunikasi jaringan.

DNS
•DNSadalahlayananjaringanyangmenerjemahkannamasituswebmenjadialamatinternet.
•DNSmenyediakanpelayananyangcukuppentinguntukInternet,ketikaperangkatkeraskomputerdanjaringanbekerjadenganalamatIPuntukmengerjakantugassepertipengalamatandanpenjaluran(routing),manusiapadaumumnyalebihmemilihuntukmenggunakannamahostdannamadomain,contohnyaadalahpenunjukansumberuniversalURL.
•AnalogiyangumumdigunakanuntukmenjelaskanfungsinyaadalahDNSbisadianggapsepertibukuteleponinternetdimanasaatpenggunamengetikkanww.indosat.net.iddiperambanwebmakapenggunaakandiarahkankealamatIP124.81.92.144(IPv4)dan2001:e00:d:10:3:140::83(IPv6).
•User tidak berhadapan langsung dengan DNS resolver-mereka berhadapan dengan program seperti web brower(Mozilla Firefox, Safari, Opera, Internet Explorer, Netscape, Konquerordan lain-lain dan klien mail (Outlook Express, Mozilla Thunderbirddan lain-lain).
•Ketika user melakukan aktivitas yang meminta pencarian DNS (umumnya, nyaris semua aktivitas yang menggunakan Internet), program tersebut mengirimkan permintaan ke DNS Resolveryang ada di dalam sistem operasi
•DNS resolverakan selalu memiliki cacheyang memiliki isi pencarian terakhir. Jika cachedapat memberikan jawaban kepada permintaan DNS, resolverakan menggunakan nilai yang ada di dalam cachekepada program yang memerlukan. Kalau cachetidak memiliki jawabannya, resolverakan mengirimkan permintaan ke server DNS tertentu. Untuk kebanyakan pengguna di rumah, Internet Service Provider(ISP)yang menghubungkan komputer tersebut biasanya akan menyediakan server DNS: pengguna tersebut akan mendata alamat server secara manual atau menggunakan DHCPuntuk melakukan pendataan tersebut. Namun jika administrator sistem / pengguna telah mengkonfigurasi sistem untuk menggunakan server DNS selain yang diberikan secara default oleh ISP misalnya seperti Google Public DNSataupun OpenDNS[1], maka DNS resolverakan mengacu ke DNS server yang sudah ditentukan. Server nama ini akan mengikuti proses yang disebutkan di Teori DNS, baik mereka menemukan jawabannya maupun tidak. Hasil pencarian akan diberikan kepada DNS resolver; diasumsikan telah ditemukan jawaban, resolverakan menyimpan hasilnya di cacheuntuk penggunaan berikutnya, dan memberikan hasilnya kepada software yang meminta pencarian DNS tersebut

DNS meliputi beberapa fungsi lainnya:
• Nama host dan alamat IP tidak berarti terhubung secara satu-banding-satu. Banyak nama host yang diwakili melalui alamat IP tunggal (virtual hosting).Hal ini memungkinkan satu komputer untuk malayani beberapa situs web.

• Sebuah nama host dapat mewakili beberapa alamat IP: ini akan membantu toleransi kesalahan ( fault tolerance ) dan penyebaran beban (load distribution), juga membantu suatu situs berpindah dari satu lokasi fisik ke lokasi fisik lainnya secara mudah.

• Ada cukup banyak kegunaan DNS selain menerjemahkan nama ke alamat IP. Contoh:, agen pemindahan surat Mail transfer agents(MTA) menggunakan DNS untuk mencari tujuan pengiriman E-mail untuk alamat tertentu. Domain yang menginformasikan pemetaan exchangedisediakan melalui rekod MX (MX record) yang meningkatkan lapisan tambahan untuk toleransi kesalahan dan penyebaran beban selain dari fungsi pemetaan nama ke alamat IP.

• Kerangka Peraturan Pengiriman (Sender Policy Framework) secara kontroversi menggunakan keuntungan jenis rekod DNS, dikenal sebagai rekod TXT.

• Menyediakan keluwesan untuk kegagalan komputer, beberapa server DNS memberikan perlindungan untuk setiap domain. Tepatnya, tigabelas server akar (root servers) digunakan oleh seluruh dunia. Program DNS maupun sistem operasi memiliki alamat IP dari seluruh server ini. Amerika Serikat memiliki, secara angka, semua kecuali tiga dari server akar tersebut. Namun, dikarenakan banyak server akar menerapkan anycast, yang memungkinkan beberapa komputer yang berbeda dapat berbagi alamat IP yang sama untuk mengirimkan satu jenis servicesmelalui area geografis yang luas, banyak server yang secara fisik (bukan sekedar angka) terletak di luar Amerika Serikat.

Jaringan Komputer : Bab 8

Jaringan Komputer

Definisi
• Sekumpulan komputer otonom yang saling terhubung satu dengan yang lainnya menggunakan protokol komunikasi melalui media transmisi pada suatu jaringan komunikasi data
• Beberapa komputer yang saling terhubung dan saling bertukar informasi.
• Dua komputer atau lebih yang saling terhubung dengan sebuah media, sehingga dapat saling berbagi resource dan berkomunikasi.
• Gabungan antara teknologi komputer dan teknologi komunikasi.
• Sekelompok komputer yang saling berhubungan dalam area tertentu.
• Menghubungkan beberapa komputer stand – alone untuk dapat berbagi (sharing).

Ciri-ciri jaringan komputer:
• berbagi perangkat keras (hardware).
• berbagi perangkat lunak (software).
• berbagi saluran komunikasi (internet).
• berbagi data dengan mudah.
• memudahkan komunikasi antar pemakai jaringan.

Dukungan Jaringan Komputer
• Resource Sharing > penggunaan sumber data & daya secara bersama-sama oleh sejumlah stasiun komputer yang terhubung.
• Information Sharing > berarti dalam suatu jaringan berlaku pemakaian program2 aplikasi secara bersama-sama.
• Network Access > kondisi dimana para pengguna dalam suatu jaringan dapat pula mengakses jaringan komputer lain yang terhubung.

Sejarah & Latar Belakang
Pada tahun 1940-an di Amerika ada sebuah penelitian yang ingin memanfaatkan sebuah perangkat komputer secara bersama. Ditahun 1950-an ketika jenis komputer mulai membesar sampai terciptanya super komputer, karena mahalnya harga perangkat komputer maka ada tuntutan sebuah komputer mesti melayani beberapa terminal. Dari sinilah maka muncul konsep distribusi proses berdasarkan waktu yang dikenal dengan nama TSS (Time Sharing System), bentuk pertama kali jaringan (network) komputer diaplikasikan. Pada sistem TSS beberapa terminal terhubung secara seri ke sebuah host komputer.

Selanjutnya konsep ini berkembang menjadi proses distribusi (Distributed Processing). Dalam proses ini beberapa host komputer mengerjakan sebuah pekerjaan besar secara paralel untuk melayani beberapa terminal yang tersambung secara seri disetiap host komputer.

Selanjutnya ketika harga-harga komputer kecil sudah mulai menurun dan konsep proses distribusi sudah matang, maka penggunaan komputer dan jaringannya sudah mulai beragam dari mulai menangani proses bersama maupun komunikasi antar komputer (Peer to Peer System) saja tanpa melalui komputer pusat. Untuk itu mulailah berkembang teknologi jaringan lokal yang dikenal dengan sebutan LAN (Local Area Network). Demikian pula ketika Internet mulai diperkenalkan, maka sebagian besar LAN yang berdiri sendiri mulai berhubungan dan terbentuklah jaringan raksasa ditingkat dunia yang disebut dengan istilah WAN (Word Area Network).
Local Area Network (LAN), merupakan jaringan milik pribadi di dalam sebuah gedung atau kampus yang berukuran sampai beberapa kilometer. LAN seringkali digunakan untuk menghubungkan komputer-komputer pribadi dan workstation dalam kantor suatu perusahaan atau pabrik-pabrik untuk memakai bersama sumberdaya (resouce, misalnya printer) dan saling bertukar informasi.
Jenis Jaringan

Metropolitan Area Network (MAN), padadasarnyamerupakanversiLAN yang berukuranlebihbesardanbiasanyamenggunakanteknologiyang samadenganLAN. MAN dapatmencakupkantor-kantorperusahaanyang letaknyaberdekatanataujugasebuahkotadandapatdimanfaatkanuntukkeperluanpribadi(swasta) atauumum. MAN mampumenunjangdata dansuara, bahkandapatberhubungandenganjaringantelevisikabel.
Wide Area Network (WAN), jangkauannya mencakup daerah geografis yang luas, seringkali mencakup sebuah negara bahkan benua. WAN terdiri dari kumpulan mesin-mesin yang bertujuan untuk menjalankan program-program (aplikasi) pemakai.
Internet. Sebenarnya terdapat banyak jaringan di dunia ini, seringkali menggunakan perangkat keras dan perangkat lunak yang berbeda-beda. Orang yang terhubung ke jaringan sering berharap untuk bisa berkomunikasi dengan orang lain yang terhubung ke jaringan lainnya. Keinginan seperti ini memerlukan hubungan antar jaringan yang seringkali tidak compatibel dan berbeda. Biasanya untuk melakukan hal ini diperlukan sebuah mesin yang disebut gateway guna melakukan hubungan dan melaksanakan terjemahan yang diperlukan, baik perangkat keras maupun perangkat lunaknya. Kumpulan jaringan yang terinterkoneksi inilah yang disebut dengan internet.

Wireless (Jaringan tanpa kabel), jaringan tanpa kabel merupakan suatu solusi terhadap komukasi yang tidak bisa dilakukan dengan jaringan yang menggunakan kabel. Misalnya orang yang ingin mendapat informasi atau melakukan komunikasi walaupun sedang berada diatas mobil atau pesawat terbang, maka mutlak jaringan tanpa kabel diperlukan karena koneksi kabel tidaklah mungkin dibuat di dalam mobil atau pesawat. Saat ini jaringan tanpa kabel sudah marak digunakan dengan memanfaatkan jasa satelit dan mampu memberikan kecepatan akses yang lebih cepat dibandingkan dengan jaringan yang menggunakan kabel.

Topologi
adalah suatu cara menghubungkan komputer yang satu dengan komputer lainnya sehingga membentuk jaringan. Cara yang saat ini banyak digunakan adalah Bus, Token-Ring, dan Star Network. Masing-masing topologi ini mempunyai ciri khas, dengan kelebihan dan kekurangannya sendiri.
A) Topologi Bus. Pada topologi Bus digunakan sebuah kabel tunggal atau kabel pusat di mana seluruh workstation dan server dihubungkan.
• Kelemahan dari topologi ini adalah setiap node dalam jaringan akan selalu ikut serta mengelola informasi yang dilewatkan dalam jaringan, sehingga bila terdapat gangguan di suatu node maka seluruh jaringan akan terganggu.
• Keunggulan topologi Ring adalah tidak terjadinya collision atau tabrakan pengiriman data seperti pada topologi Bus, karena hanya satu node dapat mengirimkan data pada suatu saat.

B) Topologi Star
Pada topologi Star, masing-masing workstation dihubungkan secara langsung ke server atau HUB. Keunggulan dari topologi tipe Star ini adalah bahwa dengan adanya kabel tersendiri untuk setiap workstation ke server, maka bandwidth atau lebar jalur komunikasi dalam kabel akan semakin lebar sehingga akan meningkatkan unjuk kerja jaringan secara keseluruhan. Dan juga bila terdapat gangguan di suatu jalur kabel maka gangguan hanya akan terjadi dalam komunikasi antara workstation yang bersangkutan dengan server, jaringan secara keseluruhan tidak mengalami gangguan. Kelemahan dari topologi Star adalah kebutuhan kabel yang lebih besar dibandingkan dengan topologi lainnya.

Keuntungan
• Paling fleksibel
• Pemasangan/perubahan stasiun sangat mudah dan tidak mengganggu bagian jaringan lain
• Kontrol terpusat
• Kemudahan deteksi dan isolasi kesalahan/kerusakan pengelolaan jaringan

Kerugian
• Boros kabel
• Perlu penanganan khusus
• Kontrol terpusat (HUB) jadi elemen kritis

Type Jaringan
Type Jaringan terkait erat dengan sistem operasi jaringan. Ada dua type jaringan, yaitu client-server dan type jaringan peer to peer
Jaringan Client – Server
Server adalah komputer yang menyediakan fasilitas bagi komputer komputer lain didalam jaringan dan client adalah komputer-komputeryangmenerimaataumenggunakanfasilitasyangdisediakanolehserver. Serverdijaringantipeclient-serverdisebutdenganDedicatedServerkarenamurniberperansebagaiserveryangmenyediakanfasilitaskepadaworkstationdanservertersebuttidkdapatberperansebagaiworkstation.

Keunggulan
• Kecepatanakseslebihtinggikarenapenyediaanfasilitasjaringandanpengelolaannyadilakukansecarakhususolehsatukomputer(server) yang tidakdibebanidengantugaslain sepertisebagaiworkstation.
• Sistemkeamanandanadministrasijaringanlebihbaik, karenaterdapatsebuahkomputeryang bertugassebagaiadministrator jaringan, yang mengelolaadministrasidansistemkeamananjaringan.
• Sistembackup data lebihbaik, karenapadajaringanclient-server backup dilakukanterpusatdiserver, yang akanmembackupseluruhdata yang digunakandidalamjaringan.

Kelemahan
• Biayaoperasionalrelatiflebihmahal.
• Diperlukanadanyasatukomputerkhususyang berkemampuanlebihuntukditugaskansebagaiserver.
• Kelangsunganjaringansangattergantungpadaserver. Bilaserver mengalamigangguanmakasecarakeseluruhanjaringanakanterganggu.

JaringanPeer To Peer
Biladitinjaudariperanserverdikeduatipejaringantersebut,makaserverdijaringantipepeertopeerdiistilahkannon-dedicatedserver,karenaservertidakberperansebagaiservermurnimelainkansekaligusdapatberperansebagaiworkstation.

Keunggulan
• Antarkomputerdalamjaringandapatsalingberbagi-pakaifasilitasyang dimilikinyaseperti: harddisk, drive, fax/modem, printer.
• Biayaoperasionalrelatiflebihmurahdibandingkandengantipejaringanclient-server, salahsatunyakarenatidakmemerlukanadanyaserver yang memilikikemampuankhususuntukmengorganisasikandanmenyediakanfasilitasjaringan.
• Kelangsungankerjajaringantidaktergantungpadasatuserver.
• Sehinggabilasalahsatukomputer/peer matiataurusak, jaringansecarakeseluruhantidakakanmengalamigangguan.

Kelemahan
• Troubleshooting jaringanrelatiflebihsulit, karenapadajaringantipepeer to peer setiapkomputerdimungkinkanuntukterlibatdalamkomunikasiyang ada. Di jaringanclient-server, komunikasiadalahantaraserver denganworkstation.
• Unjukkerjalebihrendahdibandingkandenganjaringanclient-server, karenasetiapkomputer/peer disampingharusmengelolapemakaianfasilitasjaringanjugaharusmengelolapekerjaanatauaplikasisendiri.
• Sistemkeamananjaringanditentukanolehmasing-masinguser denganmengaturkeamananmasing-masingfasilitasyang dimiliki.
• Karenadata jaringantersebardimasing-masingkomputerdalamjaringan, makabackup harusdilakukanolehmasing-masingkomputertersebut.

IP Address
IP address adalah alamat yang diberikan pada jaringan komputer dan peralatan jaringan yang menggunakan protokol TCP/IP. IP address terdiri atas 32 bit angka biner yang dapat dituliskan sebagai empat kelompok angka desimal yang dipisahkan oleh tanda titik seperti 193.160.5.1.
IP address terdiri atas dua bagian yaitu network ID dan host ID, dimana network ID menentukan alamat jaringan komputer, sedangkan host ID menentukan alamat host (komputer, router, switch). Oleh sebab itu IP address memberikan alamat lengkap suatu host beserta alamat jaringan di mana host itu berada.
Kelas-kelas IP AddressUntuk mempermudah pemakaian, bergantung pada kebutuhan pemakai, IP address dibagi dalam tiga kelas seperti diperlihatkan pada tabel dibawah
IP address kelasA diberikanuntukjaringandenganjumlahhost yang sangatbesar. Range IP 1.xxx.xxx.xxx. –126.xxx.xxx.xxx, terdapat16.777.214 (16 juta) IP address padatiapkelasA. PadaIP address kelasA, network ID ialah8 bit pertama, sedangkanhost ID ialah24 bit berikutnya. Dengandemikian, caramembacaIP address kelasA, misalnya113.46.5.6 ialah:
Network ID = 113
Host ID = 46.5.6
IP address diatasberartihost nomor46.5.6 padanetwork nomor113. IP address kelasB biasanyadialokasikanuntukjaringanberukuransedangdanbesar. PadaIP address kelasB, network ID ialah16 bit 21 pertama, sedangkanhost ID ialah16 bit berikutnya.
Dengandemikian, caramembacaIP address kelasB, misalnya132.92.121.1 :
Network ID = 132.92
Host ID = 121.1
IP address diatasberartihost nomor121.1 padanetwork nomor132.92. Denganpanjanghost ID 16 bit, network denganIP address kelasB dapatmenampungsekitar65000 host. Range IP 128.0.xxx.xxx –191.155.xxx.xxx.
IP address kelas C awalnya digunakan untuk jaringan berukuran kecil (LAN). Host ID ialah 8 bit terakhir. Dengan konfigurasi ini, bisa dibentuk sekitar 2 juta network dengan masing-masing network memiliki 256 IP address. Range IP 192.0.0.xxx –223.255.255.x.
Pengalokasian IP address pada dasarnya ialah proses memilih network ID dan host ID yang tepat untuk suatu jaringan. Tepat atau tidaknya konfigurasi ini tergantung dari tujuan yang hendak dicapai, yaitu mengalokasikan IP address seefisien mungkin.

Domain Name System (DNS)
Domain Name System (DNS) adalah suatu sistem yang memungkinkan nama suatu host pada jaringan komputer atau internet ditranslasikan menjadi IP address. Dalam pemberian nama, DNS menggunakan arsitektur hierarki :
• Root-level domain: merupakan tingkat teratas yang ditampilkan sebagai tanda titik (.).
• Top level domain: kode kategori organisasi atau negara misalnya: .com untuk dipakai oleh perusahaan; .edu untuk dipakai oleh perguruan tinggi; .gov untuk dipakai oleh badan pemerintahan. Selain itu untuk membedakan pemakaian nama oleh suatu negara dengan negara lain digunakan tanda misalnya .id untuk Indonesia atau .au untuk australia.
• Second level domain: merupakan nama untuk organisasi atau perusahaan, misalnya: microsoft.com; yahoo.com, dan lain-lain.

DHCP
IP address dan subnet mask dapat diberikan secara otomatis menggunakan Dynamic Host Configuration Protocol atau diisi secara manual. DHCP berfungsi untuk memberikan IP address secara otomatis pada komputer yang menggunakan protokol TCP/IP.
DHCP bekerja dengan relasi client-server, dimana DHCP server menyediakan suatu kelompok IP address yang dapat diberikan pada DHCP client. Dalam memberikan IP address ini, DHCP hanya meminjamkan IP address tersebut. Jadi pemberian IP address ini berlangsung secara dinamis.
Komponen Hardware dari LAN.
LAN tersusun dari beberapa elemen dasar yang meliputi komponen hardware dan software. Komponen software meliputi: Personal Computer (PC), Network Interface Card (NIC) dan Kabel. Sedangkan komponen software meliputi : Sistem Operasi Jaringan, Network Adapter Driver, Protokol Jaringan.

1. Personal Computer
Tipe personal komputer yang digunakan di dalam jaringan akan sangat menentukan unjuk kerja dari jaringan tersebut. Komputer dengan unjuk kerja tinggi akan mampu mengirim dan mengakses data dalam jaringan dengan cepat. Di dalam jaringan tipe Client-Server, komputer yang difungsikan sebagai server mutlak harus memiliki unjuk kerja lebih tinggi dibandingkan komputer-komputer lain sebagai workstation-nya, karena server akan bertugas menyediakan fasilitas dan mengelola operasional jaringan tersebut.

2. NIC
Berdasarkan tipe bus, ada beberapa tipe network interface card (nic) atau network card, yaitu ISA dan PCI. Saat ini jenis network card yang banyak digunakan, yaitu PCI.
Jenis NIC

3. Pengkabelan
Jaringan komputer pada dasarnya adalah jaringan kabel, menghubungkan satu sisi dengan sisi yang lain, namun bukan berarti kurva tertutup, bisa jadi merupakan kurva terbuka dengan terminator diujungnya). Seiring dengan perkembangan teknologi, penghubung antar komputer pun mengalami perubahan serupa, mulai dari teknologi telegraf yang memanfaatkan gelombang radio hingga teknologi serat optik dan laser menjadi tumpuan perkembangan jaringan komputer.
Hingga sekarang, teknologi jaringan komputer bisa menggunakan teknologi “kelas” museum (seperti 10BASE2 menggunakan kabel Coaxial) hingga menggunakan teknologi “langit” (seperti laser dan serat optik). Pemilihan jenis kabel sangat terkait erat dengan topologi jaringan yang digunakan. Sebagai contoh untuk jenis topologi Ring umumnya menggunakan kabel Fiber Optik (walaupun ada juga yang menggunakan twisted pair).
Topologi Bus banyak menggunakan kabel Coaxial. Kesulitan utama dari penggunaan kabel coaxial adalah sulit untuk mengukur apakah kabel coaxial yang dipergunakan benar-benar matching atau tidak. Karena kalau tidak sungguh-sungguh diukur secara benar akan merusak NIC (Network Interface Card) yang dipergunakan dan kinerja jaringan menjadi terhambat, tidak mencapai kemampuan maksimalnya. Topologi jaringan Star banyak menggunakan jenis kabel UTP.

Setiap jenis kabel mempunyai kemampuan dan spesifikasi yang berbeda, oleh karena itu dibuatlah pengenalan tipe kabel. Ada tiga jenis kabel yang dikenal secara umum, yaitu:
• Coaxial cable
• Fiber Optik
• Twisted pair (UTPunshielded twisted pair dan STP shielded twisted pair)

a. Coaxial Cable
Dikenal dua jenis kabel coaxial, yaitu thick coaxial cable (mempunyai diameter lumayan besar) dan thin coaxial cable (mempunyai diameter lebih kecil).
Thick coaxial cable (Kabel Coaxial “gemuk”)
Kabel coaxial jenis ini dispesifikasikan berdasarkan standar IEEE 802.3 10BASE5, dimana kabel ini mempunyai diameter rata-rata 12mm, dan biasanya diberi warna kuning. Kabel jenis ini biasa disebut sebagai standard ethernet atau thick Ethernet, atau hanya disingkat ThickNet, atau bahkan hanya disebut sebagai yellow cable.
Aturan Kabel Coaxial Gemuk
• Setiap ujung harus diterminasi dengan terminator 50-ohm (dianjurkan menggunakan terminator yang sudah dirakit, bukan menggunakan satu buah resistor 50-ohm 1 watt, sebab resistor mempunyai disipasi tegangan yang cukup lebar).
• Maksimum 3 segment dengan peralatan terhubung (attached devices) atau berupa populated segments.
• Setiap kartu jaringan mempunyai pemancar tambahan (external transceiver).
• Setiap segment maksimum berisi 100 perangkat jaringan, termasuk dalam hal ini repeaters.
• Maksimumpanjangkabelper segment adalah1.640 feet (atausekitar500 meter).
• Maksimumjarakantarsegment adalah4.920 feet (atausekitar1500 meter).
• Setiapsegment harusdiberiground.
• Jarakmaksimumantaratap ataupencabangdarikabelutamakeperangkat(device) adalah16 feet (sekitar5 meter).
• Jarakminimum antartap adalah8 feet (sekitar2,5 meter).

Thin coaxial cable (“Kurus”)
Kabel coaxial jenis ini banyak dipergunakan di kalangan radio amatir, terutama untuk transceiver yang tidak memerlukan output daya yang besar. Untuk digunakan sebagai perangkat jaringan, kabel coaxial jenis ini harus memenuhi standar IEEE 802.3 10BASE2, dimana diameter rata-rata berkisar 5mm dan biasanya berwarna hitam atau warna gelap lainnya. Setiap perangkat (device) dihubungkan dengan BNC Tconnector. Kabel jenis ini juga dikenal sebagai thin Ethernet atau ThinNet.
Aturan Kabel Coaxial Kurus
• Setiap ujung kabel diberi terminator 50-ohm.
• Panjang maksimal kabel adalah 1,000 feet (185 meter) per segment.
• Setiap segment maksimum terkoneksi sebanyak 30 perangkat
• jaringan (devices).
• Kartu jaringan cukup menggunakan transceiver yang onboard, tidak perlu tambahan transceiver, kecuali untuk repeater.
• Maksimum ada 3 segment terhubung satu sama lain (populated segment).
• Setiap segment sebaiknya dilengkapi dengan satu ground.
• Panjang minimum antar TConnector adalah 1,5 feet (0.5 meter).
• Maksimum panjang kabel dalam satu segment adalah 1,818 feet (555 meter).

Fiber Optic
Jaringan yang menggunakan Fiber Optic (FO) biasanya perusahaan besar, dikarenakan harga dan proses pemasangannya lebih sulit. Namun demikian, jaringan yang menggunakan FO dari segi kehandalan dan kecepatan tidak diragukan. Kecepatan pengiriman data dengan media FO lebih dari 100Mbps dan bebas pengaruh lingkungan.

Twisted Pair
Kabel Twisted Pair ini terbagi menjadi dua jenis yaitu shielded twisted pair (STP) dan unshielded twisted pair (UTP). STP adalah jenis kabel yang memiliki selubung pembungkus sedangkan UTP tidak mempunyai selubung pembungkus. Untuk koneksinya kabel jenis ini menggunakan konektor RJ-11 atau RJ-45.

Pada twisted pair (10 BaseT) network, komputer disusun membentuk suatu pola Star. Setiap PC memiliki satu kabel twisted pair yang tersentral pada HUB. Twisted pair umumnya lebih handal (reliable) dibandingkan dengan thin coax, karena HUB mempunyai kemampuan data error correction dan meningkatkan kecepatan transmisi. Saat ini ada beberapa grade atau kategori dari kabel twisted pair.

Pemberian kategori 1/2/3/4/5/6 merupakan kategori spesifikasi untuk masing-masing kabel tembaga dan juga untuk jack. Masing-masing merupakan seri revisi atas kualitas kabel, kualitas pembungkusan kabel (isolator) dan juga untuk kualitas “belitan” (twist) masing-masing pasang kabel. Selain itu juga untuk menentukan besaran frekuensi yang bisa lewat pada sarana kabel tersebut, dan juga kualitas isolator sehingga bisa mengurangi efek induksi antar kabel (noise bisa ditekan sedemikian rupa). Perlu diperhatikan juga, spesifikasi antara CAT5 dan CAT5 enchanced mempunyai standar industri yang sama, namun pada CAT5e sudah dilengkapi dengan insulator untuk mengurangi efek induksi atau electromagnetic interference. Kabel CAT5e bisa digunakan untuk menghubungkan network hingga kecepatan 1Gbps.

UTP Cable (CAT5 / CAT5e)
Kategori 5 atau 5e adalah yang paling reliable dan memiliki kompabilitas yang tinggi, dan yang paling disarankan, baik pada 10 Mbps dan Fast Ethernet (100Mbps). Konector yang bisa digunakan untuk UTP Cable CAT5 adalah RJ-45. Untuk penggunaan koneksi komputer, dikenal 2 buah tipe penyambungan kabel UTP ini, yaitu straight cable dan crossover cable. Fungsi masing-masing jenis koneksi ini berbeda, straight cable digunakan untuk menghubungkan client ke HUB/Router, sedangkan crossover cable digunakan untuk menghubungkan client ke client atau dalam kasus tertentu digunakan untuk menghubungkan HUB ke HUB.

Straight Cable
Menghubungkan ujung satu dengan ujung lain dengan satu warna. Sebenarnya urutan warna dari masing-masing kabel tidak menjadi masalah, namun ada standard secara internasional yang digunakan untuk straight cable ini

Walaupun secara fisik hardware telah dipasang (komputer dan NIC, pengkabelan, konektor, dan HUB, dll), tapi jaringan komputer belum dapat difungsikan. Karena setiap device yang dipasang butuh driver yang harus diinstal dan perlu dikonfigurasikan terlebih dahulu. Dalam modul ini akan dibahas instalasi dan konfigurasi jaringan dengan sistem operasi windows.
Selanjutnya akan dilakukan pengujian apakah komputer telah terhubung dengan benar, dan bisa berhubungan dengan jaringan lokal (LAN).

Uji Konektivitas
Setelah proses instalasi dan konfigurasi sistem jaringan (baik hardware maupun software) selesai, maka perlu dilakukan test/uji. Hal ini dimaksudkan untuk melihat apakah instalasi (mulai dari memasang kabel sampai dengan konfigurasi sistem secara software) telah dilakukan dengan benar.
Untuk mengetest TCP/IP, salah satu caranya dapat dilakukan dengan instruksi ipconfig yang dijalankan under DOS.

Perintah IPConfig digunakan untuk melihat indikasi pada konfigurasi IP yang terpasang pada Komputer kita. dari gambar diatas kita dapat melihat beberapa informasi penting setelah kita menjalankan perintah IPConfig pada jendela command prompt di komputer kita, misalnya adalah kita bisa melihat Host Name, primary DNS jaringan, physical Address dan sebagainya. Harus diingat bahwa perintah ini dapat dijalankan dengan baik apabila telah terpasang Network Card di komputer anda. Ipconfig menampilkan informasi berdasarkan Network Card yang terpasang.

Untuk mendeteksi apakah hubungan komputer dengan jaringan sudah berjalan dengan baik, utilitas ping dapat digunakan.
Utilitas ping digunakan untuk mengecek apakah jaringan kita sudah bisa berfungsi dan terhubung dengan baik, misalkan pada gambar diatas terlihat perintah ping LocalHost, jika kita melihat ada keluar pesan Replay form No IP ( 127.0.0.1 ) besarnya berapa bites dan waktunya berapa detik itu menandakan bahwa perintah untuk menghubungkan ke LocalHost dapat berjalan dan diterima dengan baik, namun seandainya jika kita melakukan ping untuk nomor IP yang tidak dikenal seperti gambar 20 diatas maka akan dikeluarkan pesan Request Time Out yang berarti nomor IP tidak dikenal dalam jaringan tersebut (ping 192.168.0.90).
Misalkan telah men-setup 2 buah terminal dengan alamat IP 202.159.0.1 dan 202.159.0.2, anda dapat melakukan test ping di mode dos dengan mengetik “PING 202.159.0.2″ dari terminal dengan IP address 202.159.0.1 dan anda akan mendapatkan respon seperti:
Pinging 202.159.0.2 with 32 bytes of data:
Reply from 202.159.0.2: bytes=32 time<10ms TTL=32
Reply from 202.159.0.2: bytes=32 time<10ms TTL=32
Reply from 202.159.0.2: bytes=32 time<10ms TTL=32
Reply from 202.159.0.2: bytes=32 time<10ms TTL=32

Jika mendapatkan respon seperti diatas, maka koneksi jaringan sudah benar. Respon lain selain contoh diatas diartikan bahwa jaringan anda belum bekerja dengan benar. Kesalahan dapat saja terjadi di sistem pengkabelan, kartu jaringan, atau setup network.
Catatan : TTL adalah Time To Live, yaitu batasan waktu agar paket data tersebut tidak mengambang dijaringan.

Pemasangan NIC
• Pemasangan Kartu jaringan pada motherboar disesuaikan dengan kartu jaringan yang dimiliki apakah menggunakan model ISA atau PCI. Kartu jaringan model ISA tidak dapat dipasangkan pada slot PCI dan sebaliknya. Jadi pemasangan kartu jaringan harus sesuai dengan slot ekspansinya. Karena ukuran slot ekspansi yang tidak sama maka mempermudah dalam pemasangan sehingga tidak mungkin tertukar. Pemasangan kartu jaringan dapat dilakukan pada slot manapun selama slot tersebut tidak dipakai oleh komponen lain atau masih kosong.
Karena apabila anda memindah komponen yang sudah ada maka saat menghidupkan komputer windows akan mendeteksi ulang pada seluruh komponen sehingga akan melakukan inisialisasi ulang ini terjadi pada windows 98, Windows 2000 dan windows XP.

Pemasangan UTP > Konektor
Pemasangan Kabel UTP dan Konektor RJ 45 untuk jaringan susunan kabel harus dilakukan standarisasi dengan tujuan untuk mempermudah dalam penambahan jaringan baru tanpa harus melihat susunan yang dipakai jika telah menggunakan standarisasi pengurutan kabel UTP ke konektor RJ 45.

Kabel Lurus (Straight Cable)
Kabel lurus (Straight Cable) adalah sistem pengkabelan antara ujung satu dengan yang lainnya adalah sama. Kabel lurus (Straight Cable) digunakan untuk menghubungkan antar workstation (Client) dengan Hub/Switch.

Kabel Silang (Crossover Cable)
Kabel Silang (Crossover Cable) adalah sistem pengkabelan antara ujung satu dengan yang lainnya saling disilangkan antar pengiriman (Transmiter) data dan penerima (Resiver) data. Kabel pengiriman data ujung satu akan diterima oleh penerima data pada ujung kedua begitupula sebaliknya penerima data satu merupakan pengirim data ujung kedua. Kabel Silang (Crossover Cable) digunakan untuk menghubungkan Hub/Switch dengan Hub/Switch atau antar dua komputer tanpa menggunakan hub.

Pemasangan Kabel UTP dengan konektor RJ 45 pada Topologi Star adalah setiap node akan menuju node pusat/ sentral sebagai konselor. Aliran data akan menuju node pusat baru menuju ke node tujuan. Topologi ini banyak digunakan di berbagai tempat karena memudahankan untuk menambah, megurangi atau mendeteksi kerusakan jaringan yang ada.
Gambaran pemasangan kabel UTP dengan konektor RJ 45 pada Topologi Star adalah sebagai berikut:

Pengisian IP Address & Subnet Mask
IP Address merupakan alamat komputer yang unik dalam sistem jaringan. Karena dalam sistem jarigan yang dituju adalah IP Address sehingga jika terjadi IP Address yang sama maka kedua komputer cross penggunaan alamat yang sama.
Setiap alamat IP terdiri dari dua field, yaitu:
· Field NetId; alamat jaringan logika dari subnet dimana komputer dihubungkan
· Field HostId; alamat device logical secara khusus digunakan untuk mengenali masing-masing host pada subnet.

Kelas A
Oktet pertamanya mempunyai nilai 0 sampai 127, dan pengalamatan Kelas A masing-masing dapat mendukung 16.77.214 host.
Kelas A hanya menggunakan octet pertama ID jaringan, tiga
octet yang tersisa disediakan untuk digunakan sebagai HostId.
Karakteristik Kelas A:
• Bit pertama : 0
• panjang NetlD : 8 bit
• Panjang HostlD : 24 bit
• Byte pertama : 0-127
• Jumlah : 126 kelas A (0 dan 127 dicadangkan)
• Range IP : 1.xxx.xxx.xxx sampai dengan 126.xxx.xxx.xxx
• Jumlah IP : 16.777.214 IP Address pada tiap kelas A

Kelas B
Oktet pertamanya mempunyai nilai 128 sampai 191, dan pengalamatan Kelas B masing-masing dapat mendukung 65.532 host.
Karakteristik Kelas B:
• 2 Bit pertama : 10
• panjang NetlD : 16 bit
• Panjang HostlD : 16 bit
• Byte pertama : 128-191
• Jumlah : 16.384 kelas B
• Range IP : 128.xxx.xxx sampai dengan 191.155.xxx.xxx
• Jumlah IP : 65.532. IP Address pada tiap kelas B

Kelas C
Oktet pertamanya mempunyai nilai 192 sampai 223, dan pengalamatan Kelas B masing-masing dapat mendukung 256 host.
IP Addrress Kelas C sering digunakan jaringan berskala kecil.
Karakteristik Kelas C:
• 3 Bit pertama : 110
• Panjang NetlD : 24 bit
• Panjang HostlD : 8 bit
• Byte pertama : 192-223
• Jumlah : 256 kelas B
• Range IP : 192.0.0.xxx sampai dengan 223.255.255.xxx
• Jumlah IP : 254 IP Address pada tiap kelas C

Subnetmask
Nilai subnetmask untuk memisahkan network id dengan host id. Subnetmask diperlukan oleh TCP/IP untuk menentukan apakah jaringan yang dimaksud adalah jaringan local atau non local.
Network ID dan host ID di dalam IP address dibedakan oleh penggunaan subnet mask. Masing-masing subnet mask merupakan pola nomor 32-bit yang merupakan bit groups dari semua (1) yang menunjukkan network ID dan semua nol (0) menunjukkan host ID dari porsi IP address.

SO
Sistem operasi merupakan penghubung antara pengguna komputer dengan perangkat keras komputer. Pengertian sistem operasi secara umum adalah suatu pengelola seluruh sumber-daya yang terdapat pada sistem komputer dan menyediakan sekumpulan layanan ke pemakai sehingga memudahkan penggunaan dan pemanfaatan sumber daya sistem komputer.
Sistem operasi jaringan atau sistem operasi komputer yang dipakai sebagai server dalam jaringan komputer hampir mirip dengan sistem operasi komputer stand alone, bedanya hanya pada sistem operasi jaringan, salah satu komputer harus bertindak sebagai server bagi komputer lainnya. Sistem operasi dalam jaringan disamping berfungsi untuk mengelola sumber daya dirinya sendiri juga untuk mengelola sumber daya komputer lain yang tergabung dalam jaringan.
Sistem operasi harus diinstal ke dalam komputer agar dapat berfungsi dengan baik. Dalam instalasi sistem operasi jaringan terdapat beberapa mode pilihan yang disediakan yaitu berupa mode text dan mode grafik. Instalasi sistem operasi berbasis text merupakan salah satu mode instalasi sistem operasi komputer dengan tampilan text. Mode text digunakan jika spesifikasi hardware komputer yang akan diinstal mempunyai spesifikasi yang rendah. Metode instalasi berbasis text akan mempercepat proses instalasi walaupun dengan tampilan yang kurang menarik dibandingkan dengan mode Grafis (GUI).
Metode instalasi sistem operasi berbasis GUI, mempunyai tampilan grafis yang lebih menarik dan memudahkan dalam proses instalasi sehingga sering dipilih oleh pemakai sistem operasi. Dengan perkembangan hardware komputer yang semakin baik menjadikan faktor kecepatan tidak menjadi kendala dalam proses instalasi.
Sistem operasi komputer telah mengalami perkembangan yang sangat pesat baik untuk keperluan stand alone maupun jaringan. Ada banyak sistem operasi komputer yang dapat digunakan dalam sebuah komputer baik stand alone maupun jaringan diantaranya adalah Microsoft Windows Series (Win 3.1, Win 9x, Win ME, Win 2000, Win XP, Win NT), Unix, San Solaris, Linux Series (Redhat, Debian, SUSE, Mandrake, Knoppix), Mac, dan lain sebagainya. Masing-masing sistem operasi memiliki kelebihan dan kekurangan sehingga diperlukan analisis dalam memilih sistem operasi mana yang sesuai dengan kebutuhan.

NOS GUI
• Seperti pada sistem operasi yang dapat digunakan pada PC, sistem operasi jaringan juga bermacam-macam. Banyak perusahaan yang mengembangkan sistem operasi jaringan dari yang komersial sampai dengan sistem operasi yang bersifat free alias gratis. Sistem operasi memegang peranan yang sangat vital terhadap program yang akan berjalan. Pemilihan sistem operasi harus disesuaikan dengan kebutuhan baik hardware, program yang akan dipakai maupun user yang akan memakai sistem.
Microsoft Windows NT, Windows 2000 Server danWindows 2003 Server merupakansistemoperasijaringanyang dikembangkanolehperusahaanMicrosoft denganlisensikomersial. UntukmenggunakansistemoperasijaringandariMicrosoft kitaharusmembayarlisensiataumembelisesuaidengankebutuhandankesepakatanantarapenggunadenganperusahaan.

SelainMicrosoft perusahaanyang mengembangkansistemoperasijaringanadalahUnix, San Solaris danperusahaanlainnya. Salahsatusistemoperasijaringanyang dikembangkansecaradenganfree adalahLinux. Linux dikembangkanpertamakali olehLinusTorvalds, mengusungproyekopen source denganlisensiGNU/GPL (General Public Licence) yaitusuatulisensidimanapemilikprogram tetapmemeganghaknyatetapioranglain dimungkinkanuntukmenyebarkan, memodifikasi, ataubahkanmenjualkembaliprogram tersebuttetapidengansyaratsource code aslidanhakciptaharusdiikutsertakandalamdistribusinya. Dengankonsepinisemuaorangdapatikutmengembangkansistemoperasidansoftware berbasislinux.

Dengan lisensi GNU/GPL Linux menjadi salah satu sistem operasi yang mengalami perkembangan yang sangat cepat, karena Linux dikembangkan oleh komunitas pengguna sistem operasi open source.
Kelemahan sistem operasi atau yang sering disebut dengan “Bug” akan segera diperbaiki oleh komunitas pengguna linux dan dapat langsung didistribusikan dengan free. Dengan demikian sistem operasi Linux menjadi sistem operasi yang up to date setiap saat.

Mungkin anda masih bingung dengan Lisensi GNU/GPL, kalau demikian perusahaan atau orang yang mengembangkan Linux dari mana mendapat keuntungan?. Yang dimaksud dengan GNU/GPL disini adalah bahwa sistem operasi yang dikembangkan memang bersifat free tetapi pengembang dapat juga menjualnya dengan harga yang tidak terlalu mahal dan perusahaan dapat memperoleh keuntungan dari jasa pelayanan instalasi, pelatihan, implementasi sistem dan lain sebagainya.

Jaringan Komputer : Bab 7

JARINGAN KOMPUTER

Jaringan komputer adalah Hubungan antara 2 komputer atau lebih yang terhubung dengan media transmisi kabel atau tanpa kabel (wireless)
Tiap komputer, printer atau periferal yang terhubung dalam jaringan disebut dengan ”node”. Sebuah jaringan komputer sekurang-kurangnya terdiri dari dua unit komputer atau lebih, dapat berjumlah puluhan komputer, ribuan atau bahkan jutaan node yang saling terhubung satu sama lain .

MODEL JARINGAN KOMPUTER :
• PEER to PEER

Image

 

• Kelebihan:
1. Tidak terlalu mahal.
2. Tidak memerlukan software administrasi jaringan yang khusus.
3. Tidak memerlukan administrator jaringan.

• Kekurangan:
1. Jaringan tidak bisa terlalu besar.
2. Tidak terpusat.
3. Tingkat keamanan rendah.

• CLIENT SERVER

Image

• Kelebihan:
1. Terpusat.
2. Mendukung keamanan jaringan yang lebih baik.
3. Kemudahan administrasi ketika jaringan bertambah besar.

• Kekurangan:
1. Butuh administrator jaringan yang profesional.
2. Butuh perangkat bagus untuk digunakan sebagai komputer server.
3. Butuh software untuk mempermudah manajemen jaringan.
4. Bila server down, semua data dan resource diserver tidak bisa diakses.

JENIS JENIS JARINGAN KOMPUTER

LAN (Local Area Network)

Image

LAN adalah Jaringan yang dibatasi oleh area yang relatif kecil, biasanya hanya sekitar 1 km persegi (misal : sebuah perkantoran di sebuah gedung, atau sebuah sekolah)

MAN (Metropolitan Area Network)

Image

Jaringan menghubungkan beberapa buah jaringan-jaringan kecil ke dalam lingkungan area yang lebih besar.
Contoh : jaringan Bank di beberapa kantor cabang dalam sebuah kota besar dihubungkan antara satu dengan lainnya.

WAN (Wide Area Network)

Image

Interwork (Internet)

Image

1. Tidak memungkinkan jaringan kabel
2. Pengembangan dari Jaringan Komputer Metropolitan
3. Melibatkan teknologi telekomunikasi canggih (satelit, gelombang elektronik lain)
Examples of Area Network

Image

MEDIA JARINGAN

• CABLE (Coaxial cable, UTP cable, Fiber optic)

Image

• Network Interface Card (Network Adapter)

Image

NIC atau Network Interface Card adalah hardware jaringan komputer yang berbentuk circuit board yang memberikan kemampuan komunikasi jaringan ke dan dari komputer client.

• LAN Tester

Image

• HUB dan SWITCH (konsentrator)

Image

Hub dan Switch hanya berperan dalam menerima dan meneruskan data-data yang masuk, memperkuat sinyal elektrik, dan menyebarkan data-data ke semua device (alat) dalam jaringan komputer.
Ciri-ciri yang dimiliki Konsentrator adalah :
1. Biasanya terdiri dari 8, 12, atau 24 port RJ-45
2. Digunakan pada topologi Bintang/Star
3. Biasanya di jual dengan aplikasi khusus yaitu aplikasi yang mengatur manajemen port tersebut.

• ROUTER

Image

Sebuah Router mampu mengirimkan data/informasi dari satu jaringan ke jaringan lain yang berbeda, router hampir sama dengan bridge, meski tidak lebih pintar dibandingkan bridge, namun pengembangan perangkat router dewasa ini sudah mulai mencapai bahkan melampaui batas tuntutan teknologi yang diharapkan

• REPEATER dan BRIDGE

Image

Fungsi utama repeater yaitu untuk memperkuat sinyal dengan cara menerima sinyal dari suatu segmen kabel LAN lalu memancarkan kembali dengan kekuatan yang sama dengan sinyal asli pada segmen kabel yang lain. Dengan cara ini jarak antara kabel dapat diperjauh.
Fungsi dari bridge itu sama dengan fungsi repeater tapi bridge lebih fleksibel dan lebih cerdas dari pada repeater. Bridge dapat menghubungkan jaringan yang menggunakan metode transmisi yang berbeda. Misalnya bridge dapat menghubungkan Ethernet baseband dengan Ethernet broadband.

TOPOLOGI JARINGAN KOMPOTER

Topologi adalah struktur fisik dari jaringan komputer yang digunakan untuk mengimplementasikan sebuah LAN. Klasifikasi topologi antara lain:
• Topologi Bus

Image

Sebuah topologi tunggal yang melalui kabel lurus panjang dimana semua hosts dikoneksikan secara langsung.
• Topologi Ring

Image

Sebuah topologi yang setiap node-nya dipertemukan kembali sehingga membentuk suatu lingkaran.
• Topologi Star

Image

Sebuah topologi yang setiap node-nya terkoneksi ke jaringan melewati sebuah hub atau concentrator.
• Topologi Tree

Image

Sebuah topologi yang terdiri dari beberapa workstation berbentuk topologi star dan terkoneksi ke kabel utama yang menggunakan topologi bus

Jaringan Komputer : Bab 6

IP ADDRESSING

6.1. Internet dan IP Address
Network layer bertanggung jawab untuk navigasi data melalui jaringan. Fungsi dari network layer adalah mendapatkan path yang terbaik dalam satu jaringan. Peralatan – peralatan menggunakan schema pengalamatan network layer untuk menentukan tujuan data ketika data berpindah dalam jaringan.
Agar dua system dapat berkomunikasi maka system – system tersebut harus dapat mengindentifikasi satu dengan lainnya, seperti dapat dilihat pada gambar berikut :

JARKOM

Meskipun alamat – alamat diatas bukanlah alamat jaringan yang actual, tapi alamat – alamat tersebut menunjukkan konsep pengelompokan alamat. A dan B mengidentifikasi jaringan dan urutan nomor mengindentifikasi individual host. Kombinasi dari huruf (network address) dan nomor (hosr address) menciptakan satu alamat unik untuk setiap device dalam jaringan. Setiap computer dalam jaringan TCP/IP harus diberikan satu pengenal unik atau biasa disebut dengan alamat. Alamat tersebut memungkinkan satu computer dapat berkomunikasi dengan computer lainnya.
Satu computer dapat dihubungkan ke lebih dari satu jaringan, seperti pada gambar 6.2 berikut ini. Pada gambar tersebut dapat dilihat bahwa satu computer dihubungkan kedua jaringan yang berbeda. Ini dilakukan dengan menempatkan dua Network Interface Card dalam computer tersebut dan dikenal dengan dual – home device.

JARKOM

Hal penting yang perlu diingat disini adalah bahwa dua interface computer tersebut berada dalam jaringan yang berbeda dan juga memiliki pengenal berbeda dalam pengalamatan. Satu hal lagi bahwa computer ini tidak melewatkan data pada masing – masing interfacenya kecuali jika dikonfigurasi dengan cara tertentu. Pada gambar diatas dual homed computer mempunyai access kedua jaringan berbeda. Jika hal ini terjadi, maka system harus diberikan lebih dari satu alamat, setiap alamat mengidentifikasi koneksinya ke satu jaringan yang berbeda. Jelasnya bahwa setiap peralatan tidak dapat dikatakan mempunyai satu alamat , tetapi setiap titik koneksi (interface) ke satu jaringan mempunyai alamat yang mengijinkan computer – computer lainnya berkomunikasi dengan interface tersebut.

6.2. Format IP Address
Dalam computer, IP address disimpan dalam bentuk 32 bit seperti terlihat pada gambar dibawah ini

JARKOM

Untuk membuat IP address lebih mudah digunakan, biasanya IP address ditulis sebagai 4 bilangan decimal yang dipisahkan oleh titik. Sebagai contoh IP address dari satu computer adalah 192.168.1.2. Komputer lainnya mempunyai address 128.10.2.1. Cara penulisan ini dikenal dengan dotted decimal format. Dalam notasi ini, setiap IP address ditulis sebagai 4 bagian dipisahkan oleh titik. Setiap bagian alamat disebut octet karena tersusun atas 8 digit binary. Sebagai contoh IP address 192.168.1.8 adalah 11000000.10101000.00000001.00001000 dalam notasi binary. Notasi decimal adalah metode yang lebih mudah dipahami dibandingkan dengan notasi biner.

6.3. IPv4 Addressing
Internet Protocol meneruskan paket dari jaringan asal ke jaringan tujuan, seperti yang dapat dilihat pada gambar 6.4 dibawah ini. Skema pengalamatan ini, oleh karenanya harus mencakup satu identifier baik untuk jaringan sumber maupun tujuan. Dengan menggunakan identifier jaringan tujuan, IP dapat membawa paket ke jaringan tujuan tersebut. Ketika paket tiba pada router yang dihubungkan ke jaringan tujuan, IP harus melokasikan computer tertentu yang dihubungkan ke jaringan tersebut. Prinsip kerja tersebut hampir sama dengan system pengiriman surat.

JARKOM

Bagian yang pertama mendefinisikan jaringan dimana system dihubungkan dan bagian kedua mendefinisikan system tertentu pada jaringan. Jenis pengalamatan ini dikenal dengan pengalamatan hirarki karena pengalamatan ini mempunyai tingkat – tingkat berbeda seperti pada gambar berikut :

JARKOM

Seperti yang terlihat pada gambar 6.6 di atas setiap octet memiliki range dari 0 sampai 255. Setiap octet dipecahkan menjadi 256 subgroups dan kemudian setiap subgroups dipecahkan lagi menjadi 256 subgroups dimana masing – masing mempunyai 256 address. IP address menggabungkan 2 identifiers dalam satu bilangan. Bilangan ini harus unik dan alamat yang duplikat tidak diperbolehkan karena akan menyebabkan konflik. Identifier yang pertama menjelaskan alamat jaringan dan bagian kedua merupakan bagian host yang menunjuk pada bagian mesin tertentu dalam jaringan tersebut. Bagaimana user menentukan bagian mana dari IP address yang menentukan jaringan dan bagian mana yang menentukan host ? Jawabannya dimulai dengan pendesign internet, yang berpikir bahwa jaringan akan dibangun dengan ukuran – ukuran berbeda, tergantung pada jumlah computer (host) yang dimiliki seperti pada table berikut :

JARKOM
Perlu ditambahkan bahwa IP Address dengan range 127.x.x.x direserved sebagai loopback address yang digunakan untuk maksud testing dan diagnosa.
Designer membagi alamat – alamat IP address yang tersedia menjadi class – class untuk mendefinisikan jaringanukuran besar (Class A), medium (Class B) dan kecil (Class C). Mengetahui class dari suatu IP address adalah langkah pertama dalam menentukan bagian mana yang menentukan jaringan dan bagian mana yang menentukan host.

6.4. IP Address Class A,B,C,D dan E
Untuk mengakomodir ukuran jaringan yang berbeda dan mengklasifikasikan ukuran jaringan tersebut, IP address dibagi dalam beberapa group yang disebut class, seperti terlihat pada gambar 6.7 dibawah ini :

JARKOM

Setiap IP address yang terdiri atas 32 bit terbagi atas bagian network dan host. Bit atau urutan bit pada permulaan setiap alamat menentukan class dari address tersebut. Ada lima IP address class, sebagai berikut :
6.4.1. Class A Address
Class A seperti yang ditunjukkan pada gambar berikut didesign untuk jaringan yang sangat besar.

JARKOM

IP address class A hanya menggunakan octet yang pertama untuk menunjukkan network address. Tiga octet lainnya digunakan untuk host address. Bit pertama dari class A selalu 0, sehingga bilangan terendah dari class A adalah 00000000 (decimal 0) dan bilangan tertinggi adalah 01111111 (decimal 127). Namun demikian 0 dan 127 tidak dapat digunakan sebagai satu network address. Setiap alamat yang nilai octet pertamanya diantara 1 dan 126 merupakan alamat class A

6.4.2. Class B Address
Seperti pada gambar 6.9, class B didesain untuk jaringan yang cukup besar.

JARKOM

Class B menggunakan dua octet yang pertama untuk menunjukkan network address dan dua octet lainnya untuk host address. Dua bit pertama pada octet yang pertama di class B selalu 10, sehingga bilangan terendah dari class B adlah 10000000 (decimal 128) dan bilangan tertinggi 10111111(decimal 191). Setiap alamat yang dimulai dengan nilai berada pada range 128 sampai 191 di octet yang pertama adalah class B address.

6.4.3. Class C Address
Class ini paling banyak digunakan dan dipakai pada jaringan – jaringan yang kecil.

JARKOM

 

Alamat class C mulai dengan binary 110, sehingga bilangan terendah adalah 11000000 (decimal 192) dan bilangan tertinggi 11011111 (decimal 223).

6.4.4. Class D Address
Class D seperti ditunjukkan pada gambar 6.11 diciptakan untuk memungkinkan multicasting dalam IP address.

JARKOM

 

Multicast address adalah network address unik yang meneruskan paket ke sekelompok (groups) IP address . Karena multicasting addres maka satu station dapat mentransmisikan secara serentak data stream ke sekelompok penerima.
Alamat class D seperti alamat class lainnya secara matematis dibatasi. Empat bit pertama dari class D harus 1110 sehingga range class D berada pada 224 sampai 239.

6.4.5. Class E Address
Meskipun telah didefinisikan, namun class ini direserved dan hanya dipakai untuk kepentingan penelitian. Empat bit dari class E selalu 1111 sehingga range octet pertama dari class ini adalah 240 sampai 255.
Tabel berikut menunjukkan range IP address untuk setiap class :

JARKOM

 

6.5. Reserved IP Address
Alamat – alamat IP tertentu direserved dan tak dapat diberikan pada device dalam satu jaringan. Alamat – alamat tersebut meliputi :
> Network address; digunakan untuk mengidentifikasi jaringan itu sendiri
> Broadcast address; digunakan untuk broadcast paket – paket ke semua device dalam satu jaringan
IP address yang mempunyai binary 0 dalam semua host bit direserved untuk network address. Router menggunakan network IP address ketika meneruskan data dalam internet. Sebagai contoh IP address 176.10.0.0 direserved untuk network address dan tidak pernah digunakan sebagai address dari satu device. Contoh IP address untuk satu device pada jaringan 176.10.0.0 adalah 176.10.16.1; dimana 176.10 adalah network address dan 16.1 adalah host address.
Untuk mengirim data ke semua device dalam satu jaringan digunakan broadcast address. Broadcast terjadi ketika satu sumber mengirim data ke semua devices dalam satu jaringan, contoh IP address 176.10.255.255. IP address ini adalah broadcast address untuk jaringan 176.10.0.0. Ketika paket dikirim ke alamat tujuan 176.10.255.255 maka paket tersebut akan diproses oleh setiap computer. Untuk menjamin bahwa semua devices dalam jaringan memproses broadcast, pengirim harus menggunakan alamat IP tujuan yang dikenal oleh seluruh devices. Broadcast IP address menggunakan binary 1 pada bit host.
6.6. Public dan Private IP Address
Kestabilan internet tergantung secara langsung pada keunikan network address yang digunakan.

JARKOM

 

Pada gambar diatas kedua jaringan mempunyai network address198.150.11.0. Ketika data yang ditransmisikan mencapai rauter, maka jaringan mana yang akan meneruskannya ? Skema jaringan seperti diatas akan meningkatkan traffic jaringan dan akan mengganggu fungsi router. Oleh karenanya, mekanisme dibutuhkan untuk menjamin bahwa alamat itu unik dan ini menjadi tanggung jawab satu lembaga yang bernama Internet Assigned Numbers Authority (IANA).
Public IP address adalah unik dan tidak ada dua computer yang terhubung ke public network mempunyai IP address yang sama karena public IP addres bersifat global dan standart. Public IP address harus diperoleh dari Internet Servic Provider (ISP) dengan biaya tertentu.
Karena pesatnya perkembangan internet, public IP address mulai habis sehingga skema pengalamatan baru seperti CIDR dan IPv6 dikembangakan untuk mengatasi masalah ini. Solusi lain yang dikembangkan adalah dengan menggunakan private IP address seperti dapat dilihat pada table berikut ini :

JARKOM

Seperti yang dituliskan diatas internet host membutuhkan unik address yang bersifat global. Jaringan private yang tidak terhubung ke internet dapat menggunakan alamat yang valid apapun sepanjang alamat tersebut valid dalam satu jaringan private. Private network kebanyakan berada dalam suatu public network
Jika kita melakukan pengalamatan satu nonpublic intranet, lab atau jaringan dalam rumah maka private address dapat digunakan. Private address dapat digunakan dengan public address untuk melindungi sejumlah alamat yang digunakan dalam satu jaringan internal. Menghubungkan satu jaringan ke internet dengan menggunakan private address membutuhkan penerjemah private address ke public address. Proses pengubahan ini disebut Network Address Translation (NAT). Router biasanya adalah device yang melakukan Network Address Translation (NAT).

Jaringan Komputer : Bab 5

Teknologi Ethernet
Pendahuluan
Teknologi Jaringan

Token Ring

FDDI
Ethernet
Token Ring

ProtokolTokendikembangkanolehIBMpadapertengahantahun1980.MetodeAksesnyamelaluilewatnyasebuahtokendalamsebuahlingkaransepertiCincin.Dalamlingkarantoken,komputer-komputerdihubungkansatudenganyanglainnyasepertisebuahcincin.SebuahSinyaltokenbergerakberputardalamsebuahlingkaran(cincin)dalamsebuahjaringandanbergerakdarisebuahkomputer-menujukekomputerberikutnya,jikapadapersinggahandisalahsatukomputerternyataadadatayanginginditransmisikan,tokenakanmengangkutnyaketempatdimanadataituinginditujukan,tokenbergerakterusuntuksalingmengkoneksikandiantaramasing-masingkomputer.
FDDI

FiberDistributedDataInterface(FDDI)adalahsebuahProtokoljaringanyangmenghubungkanantaraduaataulebihjaringanbahkanpadajarakyangjauh.MetodeaksesnyayangdigunakanolehFDDIadalahmodeltoken.FDDImenggunakanduabuahtopologiringsecarafisik.Prosestransmisibaiasanyamenggunakansatubuahring,namunjikaadamasalahditemukanakansecaraotomatismenggunakanringyangkedua.SebuahkeuntungandariFDDIadalahkecepatandenganmenggunakanfiberopticcablepadakecepatan100Mbps.
Ethernet

EthernetmenggunakanmetodeaksesyangdisebutCSMA/CD(CarrierSenseMultipleAccess/CollisionDetection).Sisteminiakanmemeriksajaringansebelummengirimdata.Jikadalamjaringantidakadaaktifitasataubersihkomputerakanmentransmisikandata,jikaadatransmisilaindidalamkabel,komputerakanmenunggudanakanmencobakembalitransmisijikajaringantelahbersih.
Pendahuluan

IdeawalEthernet,berkembangdarimasalahbagaimanamenghubungkanduaataulebihhostyangmenggunakanmediumyangsamadanmencegahinterferensisinyalsatusamalan.Masalahmultipleaccessinitelahdipelajaripadaawaltahun1970andiUniversityofHawaii.SebuahsistemyangdisebutAlohanetdikembangkanuntukmemungkinkanberbagaistasiundiHawaiidapatberbagifrekuensiradio.HasilinikemudianmembentukdasaruntukaksesEthernetyangdikenalsebagaimetodeaksesCSMA/CD(CarrierSenseMultipleAccesswithCollisionDetection).
Pendahuluan

Keterbatasanlayer 1

Layer 1 hanyaberhubunganmedia, sinyaldanbit stream yang travel melaluimedia

Layer 1 tidakdapatberkomunikasidenganlayer diatasnya

Layer 1 tidakdapatmengidentifikasikamputertujuan

Layer 1 hanyadapatmendiskripsikanbit stream

Diperlukanlayer yang lebihatasuntukmembantulayer 1 mengidentifikasikomputeryang ada

Bit stream olehlayer 2 dikelompokkanmenjadiframe dandibacauntukmengetahuialamattujuandata ditransfer

Data Link MerupakanLayer 2 padaModel OSI

Bertujuanmenyediakankoneksiantaraduakomputer/host denganmenggunakanpengalamatansecarafisik/Hardware Addressing

Komunikasihanyabisaterjadijikakeduahost/komputeryang berkomunikasitahualamatfisikmasing-masing

PengalamatansecarafisikbiasadisebutMAC Address, diambildariID NIC masing-masingkomputer
LLC (Logical Link Control)
MAC (Media Access Control)
Sublayer Data Link

Terdiridariduabagian:

Media Access Control (MAC), Sebagaiperantaralayer dibawahnya

Logical Link Control (LLC), sbgperantaralayer diatasnya
LLC –Logical Link Sublayer

LLC merupakan bagian sublayer datalink yang independent dari technology yang ada untuk menyediakan layanan ke layer network

LLC berguna dalam hal proses encapsulation.
MAC –Media Access Control Sublayer

The Media Access Control (MAC) sublayer digunakan untuk akses ke physiscal layer

Bertanggung jawab mengelompokkan bit menjadi sebuah frame atau mengurai frame menjadi 1 dan 0 untuk ditangani oleh physical layer.
LLC dan MAC
IPX
IP
APPLE-TALK
LLC
Layer 3
Layer 2 -LLC
MAC &Layer 1
Ethernet
Token Ring
FDDI
*
*
*
*
* Teknologi usang
Ethernet

Ethernet adalah suatu aturan bagaimana caranya dua atau lebih komputer menggunakan satu media untuk saling bertukar informasi

Salah satu teknologi yang paling banyak digunakan untuk tranfer data melalui media, teknologi yang lain : Token Ring dan FDDI

Kombinasi MAC dan Layer 1

Diatur pada IEEE 802.3
Ethernet

Ditemukan oleh Universitas Hawai tahun 1970-an, pertama disebut sebagai Alohanet

Dikembangkan untuk mengijinkan berbagai station pada kepulauan Hawai untuk mengakses Band Frequensi Radio secara bersama-sama di udara

Selanjutnya dipakai sebagai dasar akses di ethernet dengan metodeCSMA/CD
Ethernet

Standar pertama dipublikasikan tahun 1980 oleh sebuah konsorsium dari Digital Equipment Corporation, Intel, and Xerox (DIX)

Produk pertama yang menggunkana ethernet dijual di awal tahun 1980-an

Tahun1985, distandarisasi oleh IEEE sebagai salah satu standar yaitu 802.3
Ethernet

Gabungandarilayer 1 dansebagianlayer 2, sehinggaberhubungandengankecepatantransfer data

StandarEthernet

Kecepatan10-Mbps yang biasadisebutdenganEthernet.

Kecepatan100-Mbps biasadisebutFast Ethernet.

Kecepatan1000-Mbps biasadisebutGigabit Ethernet.

AndabisakembalimembacapadamodulPhisicallayer
MAC (Media Access Control) Address

MAC merupakanBagianEthernet yang berfungsiuntukpengalamatan

MAC Address terdiridari48 bit tetapibiasanyaditulisdalam12 bit Heksadesimaldenganketentuan6 bit sebagaikodepabrikyang ditentukanolehIEEE dan6 bit berikunyaadalahnomorserial peralatanyang dikeluarkanolehpabrik
Pengiriman Data

Untuk melakukan pengiriman data diperlukan kombinasi antara pengalamatan secara fisik dan pengalamatan secara logik

pengalamatan secara logik biasa disebut dengan IP Address (nomor IP), berada pada layer network

Nomor IP diperlukan oleh perangkat lunak untuk mengidentifikasi komputer pada jaringan

Namun nomor identitas yang sebenarnya diatur oleh NIC (Network Interface Card)atau kartu Jaringan yang juga mempunyai nomor unik.
Pengiriman data pada DataLink Layer

Penentuan waktu pengiriman data yang tepat apabila suatu media sedang terpakai, hal ini perlu melakukan suatu deteksi sinyal pembawa.

Pada Ethernet menggunakan metode Carrier Sense Multiple Access / Collision Detection (CSMA/CD).

Pada jaringan yang dapat melakukan akses secara bersamaan simultan. Maka bila Host A mengirimkan data ke Host D, maka Host B dan C akan melakukan deteksi jalur, dan apabila jalur sedang dipakai maka Host B dan C akan menunggu terlebih dahulu.
Metode CSMA/CD

sebuah host komputer yang akan mengirim data ke jaringan pertama-tama memastikan bahwa jaringan sedang tidak dipakai untuk transfer dari dan oleh host komputer lainnya (Listen).

Jika pada tahap pengecekan ditemukan transmisi data lain dan terjadi tabrakan (collision), maka host komputer tersebut diharuskan mengulang permohonan (request) pengiriman pada selang waktu berikutnya yang dilakukan secara acak (random).

Dengan demikian maka jaringan efektif bisa digunakan secara bergantian
Error Checking Pengiriman Data

Data-Link dapat melakukan deteksi error dan memberikan peringatan (notification) kepada lapisan diatasnya,bahwa terjadi kesalahan transmisi.

Teknik yang digunakan error ddetection adalah Frame Check Sequence (FCS) dan Cyclic Redundancy Check (CRC).

Data Link tidak melakukan error-correction
Data Pada Layer 2

Biasa disebut sebagai Frame

Informasi yang ada pada frame :

Kita berkomunikasi dengan siapa

Kapan komunikasi dimulai dan diakhiri

Error apa yang terjadi selama komunikasi

Setiap frame terdiri dari beberapa field : Start Frame field , Address field, Length/Type field, Data field, Frame Check Sequence (FCS) field, Extra bytes yang mungkin ditambahkan jika kurang dari panjang yang ditetapkan
Frame Ethernet Structures
Frame Ethernet Fields

Preamble berbentuk 1 dan 0 bergantian digunakan untuk sinkronisasi waktu di 10 Mbps dan implementasi ethernet yang lebih.

SOF delimiter, terdiri dari satu oktet sabagai penanda akhir informasi timing dan berisi bit sequense 10101011

Destination address dan Source Address berisi alamat MAC sumber dan tujuan.

length digunakan ketika LLC menyediakan identifikasi protocol. Harganya mengindikasikan upper layer akan menerima data setelah proses ethernet komplit.

Data field berisikan data dari layer diatasnya

Padding berisi extra data jika dibutuhkan.

FCS berisikan 4-byte CRC yang dibuat oleh peralatan yang mengirim data berisi jumlah byte yang dikirim, akan dikalkulasi lagi oleh penerima apakah jumlah data yang dikirim sama dengan jumlah byte yang diterima, jika tidak berarti terjadi kerusakan data
Peralatan Jaringan Layer 2

NIC ( Network Interface Card)

Bridge

Switch
Network Interface Card (NIC)
Network Interface Card (NIC)

http://www.whatis.com“A network interface card (NIC) is a computer circuit board or cardthat is installed in a computer so that it can be connected to a network. Personal computers and workstations on a local area network (LAN) typically contain a network interface card specifically designed for the LAN transmission technology, such as Ethernetor token ring. Network interface cards provide a dedicated, full-time connection to a network. Most home and portable computers connect to the Internet through as-needed dial-up connection. The modemprovides the connection interface to the Internet service provider.’
Network Interface Card (NIC)
Network Interface Card (NIC)
Network Interface Card (NIC)

Layer 2, Data Link Layer

Peralatan yang Menghubungkan komputer ke LAN

Bertanggung jawab dalam pengalamantan layer 2 (MAC

NIC yang umum dipasaran, untuk teknologi:

Ethernet

Token Ring

Bandwidth

10 Mbps, 10/100 Mbps, 10/100/1000 Mbps
Network Interface Card (NIC)

Routers biasanya juga didalamnya include NIC.
Bridges

Bridge merupakan switch yang hanya terdiri dari dua.

Digunakan sebagai pembagi segment dalam LAN.

Bekerja menggunakan table bridge yang berisikan port dan MAC address

Bridge belajar ttg device yang terkoneksi ke portnya untuk menentukan apakah suatu traffic perlu diforward atau tidak ke segment berikutnya
Switches

Switches merupakan peralatan untuk pada LAN Modern

Merupakan layer 2 device, bekerja berdasarkan table MAC Address.

Biasanya disebut multiport bridge

Switch belajar ttg device yang terkoneksi ke portnya untuk menentukan apakah suatu traffic perlu diforward atau tidak
Cara Kerja Switch

A switch punya source address table di cache (RAM) yang menyimpan source MAC address dan relasinya dengan Port switch setelah belajar dari traffic di jaringan.

Switch menerima frame Ethernet frame dan mengambil source address table dan Destination MAC address.

Ini akan dicocokkan dengan tabel dan hanya akan diteruskan ke port yang sesuai.

Jika tidak ditemukan seluruh port akan dikirimin data.
Source Address Table
PortSource MAC Add.PortSource MAC Add.
switch
1111
2222
3333
4444
Abbreviated MAC addresses
1111
3333
Cara KerjaSwitch

Bagaimana dia belajar ource MAC addresses?

Pertama, switch melihat SA (1111) di tablenya.

Jika tidak ada ditambahkan ke table dengan nomor port yang sesuai

Selanjutnya switch akan mengirimkan ke semua portnya dia sbb DA belum dikenal id tabel
Source Address Table
PortSource MAC Add.PortSource MAC Add.
1 1111
switch
1111
2222
3333
4444
Abbreviated MAC addresses
1111
3333
Destination Address in table, Filter

Ketika 3333 mengirim data balik ke 1111.

Switch akan menyimpan 333 ke tabelnya dia.

Selanjutnya, mengecek DA di tabelnya dia, berada pada port 1 maka difilter, hanya dikirim ke port 1, port lain tidak menerima
Source Address Table
PortSource MAC Add.PortSource MAC Add.
1 1111 6 3333
switch
1111
2222
3333
4444
Abbreviated MAC addresses
3333
1111
No Collisions in Switch, Buffering

Switch akanbelajarterussampaitabelnyakonvergen

Dengansisteminitidaksampaiterjadipemborosanbandwitdh, hanyayang menerimasajayang akandikirimidata
Source Address Table
PortSource MAC Add.PortSource MAC Add.
1 1111 6 3333
9 4444
switch
1111
2222
3333
4444
Abbreviated MAC addresses
1111
3333
4444
3333
Collision Domain

Collision Domain, merupan domain tabrakan pada suatu LAN

Terjadi karena sistem CSMA/CD memungkinkan pengiriman data secara bersamaan pada satu media, akibatnya terjadi tabrakan/collision

Hanya terjadi pada hub, tidak pernah terjadi pada switch sbb switch membuat aliran sendiri-sendiri setiap transmisi data
Broadcast Domain

Broadcast terjadi jika pengirim tidak mengetahui alamat data yang dituju, dia berusaha menyiarkan ke seluruh LAN yang ada

Semua host akan menerima data ini.

Aliran broadcast tidak bisa dicegah oleh switch, switch akan meneruskan broadcast ke seluruh port yang ada

Broadcast hanya bisa dicegah oleh router yang merupakan device layer 3

Jaringan Komputer : Bab 4

DataLinkLayer
Pendahuluan

MerupakanLayer2padaModelOSI

Bertujuanmenyediakankoneksiantaraduakomputer/hostdenganmenggunakanpengalamatansecarafisik/HardwareAddressing

Komunikasihanyabisaterjadijikakeduahost/komputeryangberkomunikasitahualamatfisikmasing-masing

PengalamatansecarafisikbiasadisebutMACAddress

MACAddressDiambilkandariIDNICmasing-masingkomputer(cmdcommand->ipconfig/all).
MAC (Media Access Control) Address

MACAddressterdiridari48bittetapibiasanyaditulisdalam12bitHeksadesimaldenganketentuan6bitsebagaikodepabrikyangditentukanolehIEEEan6bitberikunyaadalahnomorserialperalatanyangdikeluarkanolehpabrik
Pengiriman Data

Untuk melakukan pengiriman data diperlukan kombinasi antara pengalamatan secara fisik dan pengalamatan secara logik

pengalamatan secara logik biasa disebut dengan IP Address (nomor IP), berada pada layer network

Nomor IP diperlukan oleh perangkat lunak untuk mengidentifikasi komputer pada jaringan

Namun nomor identitas yang sebenarnya diatur oleh NIC (Network Interface Card)atau kartu Jaringan yang juga mempunyai nomor unik.
Pengirimandata padaDataLinkLayer

Penentuanwaktupengirimandatayangtepatapabilasuatumediasedangterpakai,haliniperluuntukdeteksisinyalpembawa.

PadaEthernetmenggunakanmetodeCarrierSenseMultipleAccess/CollisionDetection(CSMA/CD).

Padajaringanyangdapatmelakukanaksessecarabersamaansimultan.MakabilaHostAmengirimkandatakeHostD,makaHostBdanCakanmelakukandeteksijalur,danapabilajalursedangdipakaimakaHostBdanCakanmenungguterlebihdahulu.
MetodeCSMA/CD

sebuahhostkomputeryangakanmengirimdatakejaringanpertama-tamamemastikanbahwajaringansedangtidakdipakaiuntuktransferdaridanolehhostkomputerlainnya(Listen).

Jikapadatahappengecekanditemukantransmisidatalaindanterjaditabrakan(collision),makahostkomputertersebutdiharuskanmengulangpermohonan(request)pengirimanpadaselangwaktuberikutnyayangdilakukansecaraacak(random).

Dengandemikianmakajaringanefektifbisadigunakansecarabergantian
Error Checking PengirimanData

Data-Link dapatmelakukandeteksierror danmemberikanperingatan(notification) kepadalapisandiatasnya,bahwaterjadikesalahantransmisi.

Teknikyang digunakanerror ddetectionadalahFrame Check Sequence (FCS) danCyclic Redundancy Check (CRC).

Data Link tidakmelakukanerror-correction
Generic Data Link Frame Format
Preamble or Start Field

When computers are connected to a physical medium, there must be a way they can grab the attention of other computers to broadcast the message, “Here comes a frame!”

Various technologies have different ways of doing this process, but all frames, regardless of technology, have a beginning signaling sequence of bytes.

Depending up frame format: Preamble = 7 bytes, Start or Start of Frame Delimiter (SFD) = 1 byte
Generic Data Link Frame Format
Address Field

We saw how IEEE 802.3 uses Destination and Source Addresses.

By the way: Any idea how a serial data link frame is addressed?

Unicastaddress –Single device

Broadcastaddress –All devices

Multicastaddress –Specific group of devices
Generic Data Link Frame Format
Type Field

Usually information indicating the layer 3 protocols in the data field, I.e. IP Packet.

Type field values of particular note for IEEE 802.3 frames include:

0×0600 XNS (Xerox)

0×0800 IP (the Internet protocol)

0×8137 Novell NetWare packet formatted for Ethernet II

0×6003 DECNET
“Ethernet” Frame Formats
802.2
802.3
802.3
Length Field

In some frame formats such as 802.3, there is a length field which specifies the exact length of a frame.

IEEE 802.3 specification limits the data portion to a maximum of 1500 bytes.

Designed to hold a Layer 3 IP packet.

When IEEE created 802.2, it saw the need for a protocol TYPE field that identified what was inside the “data” field.

IEEE called its 1 byte type field DSAP (Destination Service Access Point).

Turned out that 1 byte was not long enough to handle all the different number of protocols.
1.
To accommodate more protocols IEEE added the SNAP (SubnetworkAccess Protocol) header.

The fields of various Ethernet framing that are used for identifying the type of data contained in a frame:

Ethernet II or DIX (DEC, Intel, Xerox) –Most common

IEEE Ethernet (802.3)

IEEE 802.3 with SNAP header
Generic Data Link Frame Format
Data Field

Included along with this data, you must also send a few other bytes.

They are called padding bytes, and are sometimes added so that the frames have a minimum length for timing purposes.

LLC bytes are also included with the data field in the IEEE standard frames. (later)
Application Header + data
Data Encapsulation Example
010010100100100100111010010001101000…
Application Layer
Layer 4: Transport Layer
Layer 3: Network Layer
Layer 2: Network Layer
Layer 1: Physical Layer
Generic Data Link Frame Format
FCS

Used to insure that the data has arrived without corruption.

More efficient than sending the data twice and comparing the results.

Necessary to prevent errors.
Three Kinds of FCS

Cyclic redundancy check (CRC)

performs polynomial calculations on the data

Two-dimensional parity

adds an 8thbit that makes an 8-bit sequence have an odd or even number of binary 1s

Internet checksum

adds the numbers to determine a number
Generic Data Link Frame Format
Stop Field (Other data link frame formats)

The computer that transmits data must get the attention of other devices, in order to start a frame, and then claim it again, to end the frame.

The length field implies the end, and the frame is considered ended after the FCS.

Sometimes there is a formal byte sequence referred to as an end-frame delimiter.

Jaringan Komputer : Bab 3

Kemampuan ahir yang diharapkan

Memahami teknologi wireless dan konsep wireless
Bahan Kajian

Tekonolgi wireless
Pendahuluan

Teknologijaringansaatinitelahberkembangdenganpesat.Berbagaimacamteknologitelahdikembangkanuntukmembantumanusiadalamberkomunikasi.Kalaupadaeratahun80-anteknologijaringankomputerhanyamengandalkanteknologijaringanberbasiskabel,saatiniteknologitersebutmulaibanyakditinggalkankarenabeberapaketerbatasannya,sepertibesarnyabiayayangharusdikeluarkanolehorganisasijikamenggunakanteknologiini(wirednetwork),selainituteknologiinijugatidakflexibelkarenasangattergantungpadakabel.Saatinikalaukitaperhatikanmulaibanyakperusahaanyangmulaimenerapkanteknologitanpakabel(wireless)atauyangbiasadisebutdenganWirelessFidelity(WiFi).HalinidapatkitalihatbanyaknyaperusahaanyangmenawarkanHotspotArea(areayangterdapatjaringaninternetberbasisWiFi)yangdapatdiaksesolehsemuaorangbaikitusecaragratismaupundengancararegistrasikepenyedialayanantersebut.
Kelebihan Wireless

Sistemkomunikasidatatanpakabel(wireless)dapatdiimplementasikansebagaiperpanjanganatausebagaialternatifpenggantiuntukkomuniksidatalewatjaringankabel.

Wirelesslocalareanetwork(LAN)adalahsistemkomunikasidatayangfleksibelyangdapatdiimplementasikansebagaipenggantiuntukLANjaringankabel.

Mobility
SistemwirelessLANbisamenyediakanuserdenganinformasiaccessyangreal-time,dimanasajadalamsuatuorganisasi.Mobilitassemacaminisangatmendukungproduktivitasdanpeningkatankualitaspelayananapabiladibandingkandenganjaringankabel

InstallationSpeedandSimplicity
InstalasisistemwirelessLANbisacepatdansangatmudahdanbisamengeliminasikebutuhanpenarikankabelyangmelaluiatapataupuntembok.

InstallationFlexibility
Teknologiwirelessmemungkinkansuatujaringanuntukbisamencapaitempat-tempatyangtidakdapatdicapaidenganjaringankabel.
Kelebihan Wireless

Reduced Cost-of-Ownership
MeskipuninvestasiawalyangdibutuhkanolehwirelessLANuntukmembeliperangkathardwarebisalebihtinggidaripadabiayayangdibutuhkanolehpeangkatwiredLANhardware,namunbiladiperhitungkansecarakeseluruhan,instalasidanlife-cyclecostnya,makasecarasignifikanlebihmurah.DanbiladigunakandalamlingkungankerjayangdinamisyangsangatmembutuhkanseringnyapergerakandanperubahanyangseringmakakeuntunganjangapanjangnyapadasuatuwireessLANakanjauhlebihbesarbiladibandingkandenganwiredLAN.

Scalability
SistemwirelessLANbisadikonfigurasikandalamberbagaimacamtopologiuntukmemenuhikebutuhanpenggunayangberagam.KonfigurasidapatdenganmudahdiubahMulaidarijaringanpeer-to-peeryangsesuaiuntukjumlahpenggunayangkecilsampaikefullinfrastructurenetworkyangmampumelayaniribuanuserdanmemungkinkanroamingdalmareayangluas.
Kelebihan Wireless
Teknologi

Perkembanganteknologiwireless(nirkabel)dalamerakomunikasidatayangsemakincepatdanmengglobalinitelahmembawamasyarakatmelewatibeberapatahapanpengembanganteknologi.

Generasipertama(1G)pengembanganteknologinirkabelditandaidenganpengembangansistemanalogdengankecepatanrendah(lowspeed)dansuarasebagaiobyekutama.
contoh:

NMT(NordicMobileTelephone)

AMPS(AnalogMobilePhoneSystem).

Generasi kedua (2G) pengembangan teknologi nirkabel dijadikan standar komersial dengan format digital, kecepatan rendah -menengah.
Contoh GSM dan CDMA2000
Generasi2,5(2,5G)yaituteknologikomunikasidatawirelesssecaradigital,kecepatanmenengah(hingga150Kbps).Teknologiyangtermasukkategori2,5G.
Contoh:

GPRS(GeneralPacketRadioService)

EDGE(EnhanceDatarateforGSMEvolution)

PDN(PacketDataNetwork)padadomainCDMA
Teknologi

Generasiketiga,generasidigitalkecepatantinggi,yangmampumentransferdatadengankecepatantinggi(high-speed)danaplikasimultimedia,untukpitalebar(broadband).Contoh:W-CDMA(ataudikenaljugadenganUMTS)danCDMA20001xEV-DO.

Generasikeempat,namaresmidariteknologi4GinimenurutIEEE(InstituteofElectricalandElectronicsEngineers)adalah”3Gandbeyond”.Sebelum4G,High-SpeedDownlinkPacketAccess(HSDPA)yangkadangkaladisebutsebagaiteknologi3,5GtelahdikembangkanolehWCDMAsamasepertiEV-DOmengembangkanCDMA2000.HSDPAadalahsebuahprotokoltelepongenggamyangmemberikanjalurevolusiuntukjaringanUniversalMobileTelecommunicationsSystem(UMTS)yangakandapatmemberikankapasitasdatayanglebihbesar(sampai14,4Mbit/detik).
Cara kerja wire less
Komponen Sistem wireless:

SinyalRadiobekerjapadalapisanbawahyangbiasadisebutdenganphysicallayer,ataulapisanfisik.LaluFormatDataatauDataFormatmengendalikanbeberapalapisandiatasnya.Danstrukturejaringanberfungsisebagaialatuntukmengirimdanmenerimasinyalradio.Saatakanmengirimdata,peralatan-peralatanWirelesstadiakanberfungsisebagaialatyangmengubahdatadigitalmenjadisinyalradio.Lalusaatmenerima,peralatantadiberfungsisebagaialatyangmengubahsinyalradiomenjadidatadigitalyangbisadimengertidandiprosesolehkomputer.
Sinyal Radio (Radio Signal).
Format Data (Data Format).
Network Structure.

Dataditransmikandengancaraditumpangkanpadagelombangpembawasehinggabisadiextractpadaujungpenerima.Datainiumumnyadigunakansebagaipemodulasidaripembawaolehsinyalinformasiyangsedangditransmisikan.Begitudatanyasudahdimodulasikanpadagelombagradiopembawa,sinyalradioakanmendudukilebihdarisatufrekuensi,haliniterjadikarenafrekuensiataubitratedariinformasiyangmemodulasiditambahkanpadasinyalcarrier.Multipleradiocarrierbisaadadalamsuaturuangdalamwaktuyangbersamaantanpaterjadiinterferensisatusamalainjikagelombangradioyangditrnsmisikanberbedafrekuensinya.Untukmengextractdata,radiopenerimanyadiaturdalamsatufrekuensidanmenolakfrekuensi-frekuensilain.
WirelessLANmenggunakanelectromagneticairwaves(radioatauinfrared)untukmenukarkaninformasidarisatutitikketitiklainnyatanpaharustergantungpadasambungansecarafisik.Gelombangradiodigunakansebagaipembawakarenadapatdenganmudahmengirimkandayakepenerima.

PadakonfigurasiwirelessLANtertentu,transmitter/receiver(transceiver)device,biasadisebutaccesspoint,terhubungpadajaringankabeldarilokasiyangfixedmenggunakankabelstandard.Sebuahaccesspointbisamensupportsejumlahgroupkecildariuserdanbisadipakaidalamjarakbeberapapuluhmeter.Accesspointbiasanyadiletakkanpadatempatyangtinggitapidapatjugadiletakkandimanasajauntukmendapatkancakupanyangdikehendaki.EnduseraccesswirelessLANmenggunakanwireless-LANadapters,biasaterdapatpadaPCcardpadanotebookataupalmtopcomputer,atausebagaicarddalamdesktopcomputer,atauterintegrasidalamhand-heldkomputer.
Karenabanyaknyajenis-jenisjaringanWLANyangadadipasaran,makastandarIEEE802.11menetapkanantarmuka(interface)antaraklienWLAN(wirelessclient)denganjaringanAccessPoint-nya(networkAPs).UntukmembedakanperbedaanantarajaringanWLANsatudenganjaringanWLANlainnya,maka802.11menggunakanServiceSetIdentifier(SSID).

DenganpenandainimakadapatdibedakanantarajaringanWLANsatudenganlainnyasebabjaringanWLANsatudenganyanglainpastimemilikinomorpenanaSSIDyangberbedapula.AccessPoint(AP)menggunakanSSIDuntukmenentukanlalulintaspaketdatamanayangdiperuntukkanuntukAccessPointtersebut.
Standarisasi
Standarisasi
Standar802.11jugamenentukanfrekuensiyangdapatdigunakanolehjaringanWLAN.Misalnyauntukindustrial,scientific,danmedical(ISM)beroperasipadafrekuensiradio2,4GHz.802.11jugamenentukantigajenistransmisipadalapisanfisikuntukmodelOpenSystemInterconnection(OSI),yaitu:direct-sequencespreadspectrum(DSSS),frequency-hoppingspreadspectrum(FHSS),daninfrared.
Standar802.11membolehkandevice(perangkat)yangmengikutistandar802.11untukberkomunikasisatusamalainpadakecepatan1Mbpsdan2Mbpsdalamjangkauankira-kira100meter.Jenislaindaristandar802.11nantiakandikembangkanuntukmenyediakankecepatantransferdatayanglebihcepatdengantingkatfungsionalitasyaglebihbaikdariyangadasaatini.Saatiniterdapatbeberapajenisvariandaristandar802.11.

Standar 802.11
1.
802.11a
2.
802.11b
3.
802.11g
Standarisasi
Walaupunstandar802.11atidakkompatibeldenganstandar802.11b,beberapavendor/perusahaanpembuatperangkatAccessPointberupayamenyiasatiinidenganmembuatsemacamjembatan(bridge)yangdapatmenghubungkanantarastandar802.11adan02.11bpadaperangkataccesspointbuatanmereka.Accesspointtersebutdibuatsedemikianrupasehinggadapatdigunakanpada2(dua)jenisstandaryaitupadastandar802.11adanstandar802.11btanpasalingmempengaruhisatusamalain.
Kelebihandaristandar802.11aadalahkarenaberoperasipadafrekuensiradio5GHzsehinggatidakperlubersaingdenganperangkatkomunikasitanpaabel(cordless)lainnyasepertitelepontanpakabel(cordlessphone)yangumumnyamenggunakanfrekuensi2,4GHz.
Perbedaanutamayanglainantarastandar802.11adenganstandar802.11dan802.11badalahbahwapadastandar802.11amenggunakanjenismodulasitamahanyangdisebutOrthogonalFrequencyDivisionMultiplexing(OFDM)padalapisanfisikdimodelOSI.
Standar 802.11b

Standar802.11bmerupakanstandaryangpalingbanyakdigunakandikelasstandar802.11.Standarinimerupakanpengembangandaristandar802.11untuklapisanfisikdengankecepatantinggi.

Standar802.11bdigunakanuntukmendefinisikanjaringanwirelessdirect-sequencespreadspectrum(DSSS)yangmenggunakangelombangfrekuensiindusrial,scientific,medicine(ISM)2,4GHzdanberkomunikasipadakecepatanhingga11Mbps.Inilebihcepatdaripadakecepatan1Mbpsatau2Mbpsyangditawarkanolehstandar802.11a.Standar802.11bjugakompatibeldengansemuaperangkatDSSSyangberoperasipadastandar802.11.
Standar 802.11g
Standar802.11gpadadasarnyamiripdenganstandar802.11ayaitumenyediakanjalurkomunikasikecepatantinggihingga54Mbps.Namun,frekuensiyangdigunakanpadastandarinisamadenganfrekuensiyangdigunakanstandar802.11byaitufrekuensigelombang2,4GHzdanjugadapatkomptibeldenganstandar802.11b.Halinitidakdimilikiolehstandar802.11a.Sepertistandar802.11.a,perangkat-perangkatpadastandar802.11gmenggunakanmodulasiOFDMuntukmemperolehkecepatantransferdataberkecepatantinggi.
Tidaksepertiperangkatperangkatpadastandar802.11a,perangkat-perangkatpadastandar802.11gdapatsecaraotomatisbergantikequadraturephaseshiftkeying(QPSK)untukberkomunikasidenganperangkatperangkatpadajaringanwirelessyangmenggunakanstandar802.11b.
JARINGAN ADHOC
JaringanWiFiAdhocadalahmodejaringanWiFiyangmemungkinkanduaataulebihdevice(komputerataurouter)untuksalingberkomunikasisatusamalainsecaralangsung(dikenaldenganistilahpeertopeer)tanpamelaluiCentralWirelessRouteratauAccesPoint(AP).SedangkanjaringanWiFiyangmenggunakansebuahAccesPointRouteruntukmenghubungkanantarasemuaclientdengansumberdayajaringanlainnyadisbutjaringanWiFimodeInfrastructure.Readmore:
Setting jaringan adhoc

KliktombolWindowsStart,padakolomSearchprogramsandfilesketik:adhockemudianenter.

JendelaSetupAdHocNetworkakanterbuka,klikNextuntukmelanjutkan
Jaringan adhoc

PadakolomNetworknameisidengannamayangakankitagunakansebagaiSSID,contohnya:catatanteknisi,Pilihmodesecurity;WEP,WPA2-PersonalatauOpen.IsiSecuritykeyisidenganpasswordmisalnyapassword,centangpilihanSavethisnetwork,kemudianklikNext
Jaringan adhoc

Setelah muncul jendela The catatanteknisi network is ready to use, klik CloseCek koneksi WiFi dengan mengklik icon wireless pada taskbar sebelah kanan, akan terlihat status catatateknisi -Waiting for users.

Jaringan Komputer : Bab 2

Kemampuan ahir yang diharapkan
Mampu memahami prinsip komunikasi

  • message formating
  • standart protocol

Bahan Kajian

  • Teknik dan model komunikasi

Format pesan

  • Message adalah struktur yang digunakan untuk mengirim informasi melalui jaringan.
  • Strukturnya sangat bervariasi tergantung protokol atau teknologi yang digunakan
  • Setiap protokol menggunakan metode format khusus yang menentukanstruktur dari message.
  • Format message secara keseluruhan cenderung mengikuti struktur yang hampir seragam

Struktur Message

  • Header

Informasi yang ditempatkan sebelum data. Header biasanya berisi sejumlah kecil byte informasi kontrol, yang digunakan untuk berkomunikasi.

  • Data

Data aktual yang ditransmisikan, sering disebut payloaddari message

  • Footer:

Informasi yang ditempatkan setelah data.

Protocol

  • Definisi

Kumpulan aturan/prosedur yang mengedalikan pengoperasian unit-unit fungsional untuk melakukan hubungan komunikasi.

  • Komponen protocol

1. Aturan atau prosedur

  • Mengatur pembentukan/pemutusan hubungan
  • Mengatur proses transfer data

2. Format atau bentuk

  • representasi pesan

3. Kosakata (vocabulary)

  • Jenis pesan dan makna masing-masing pesan

Standarisasi protocol

  • ISO(InternationalStandardOrganization)mengajukanstrukturdanfungsiprotocolkomunikasidata.ModeltersebutdikenalsebagaiOSI(OpenSystemInterconnection)ReferenceModel.
  • Terdiriatas7layer(lapisan)yangmendefinisikanfungsi.Untuktiaplayernyadapatterdiriatassejumlahprotocolyangberbeda,masing-masingmenyediakanpelayananyangsesuaidenganfungsilayertersebut.

1. Application Layer: interface antara aplikasi yang dihadapi user and resource jaringan yang diakses. Kelompok aplikasi dengan jaringan:
1.File transfer dan metode akses
2.Pertukaran job dan manipulasi
3.Pertukaran pesan

2.Presentation Layer: rutin standard me-presentasi-kan data.
1.Negosiasi sintaksis untuk transfer
2.Transformasi representasi data

3.Session Layer: membagi presentasi data ke dalam babak-babak (sesi)
1.Kontrol dialog dan sinkronisasi
2.Hubungan antara aplikasi yang berkomunikasi

4.Transport Layer:
1.Transfer pesan (message) ujung-ke-ujung
2.Manajemen koneksi
3.Kontrol kesalahan
4.Fragmentasi
5.Kontrol aliran

5.Network Layer: Pengalamatan dan pengiriman paketdata.
1.Routing
2.Pengalamatan secara lojik
3.setup dan clearing (pembentukan dan pemutusan)

6.Data-link Layer: pengiriman data melintasi jaringan fisik.
1.Penyusunan frame
2.Transparansi data
3.Kontrol kesalahan (error-detection)
4.Kontrol aliran (flow)

7.Physical Layer: karakteristik perangkat keras yang mentransmisikan sinyal data.
BEBERAPA PROTOKOL PENTING
•ICMP
•IGMP
•ARP
•RARP
•BOOTP
•DHCP
•SPX/IPX
•TCP/IP

ICMP(Internet Control Message Protocol)
DEFINISI
Merupakan standart protocol yang menyediakan kemampuan pengiriman pesan dalam IP.
CONTOH ICMP MESSAGES :
•Echo dan Echo reply
•Destination Unreachable
•Time Exceded
•Parameter Problem
•Redirect

ECHO dan ECHO REPLY
•Merupakan ICMP messages yang digunakan untuk mendeteksi host tersebut online pada jaringan atau tidak. Contoh: PING command.

DESTINATION UNREACHABLE

•Merupakan ICMP messages yang digunakan untuk memberi informasi ke host asal bahwa tidak tersambung ke host tujuan.
•Merupakan ICMP messages yang digunakan untuk memberi informasi berapa router yang dilewati agar sampai host tujuan.
•Pesan ini akan dikirim jika waktu yang ditentukan telah habis sebelum sampai pada tujuan.

PARAMETER PROBLEM
•Merupakan ICMP messages yang digunakan untuk memberi informasi apabila ada kerusakan selama proses pengiriman data.
•Pesan ini akan dikirim jika pada proses pengiriman data terdapat kerusakan.

REDIRECT
•Merupakan ICMP messages yang berfungsi untuk memilih jalur pengiriman data jika ada salah satu jalur yang rusak.
•Pesan ini akan dikirim jika terjadi perpindahan jalur dari jalur sebelumnya karena adanya kerusakan jalur sebelumnya.

IGMP (Internet Group Management Protocol)
DEFINISI
Merupakan standart IP multi cast yang digunakan untuk membangun keanggotaan host pada network.

CARA PENGIRIMAN DATA
•Unicast
•Broadcast
•Anycast
•Multicast
•Unicast

Data dikirim dari 1 host ke 1 host.
•Broadcast
Data dikirim dari 1 host langsung disebarkan ke banyak host.

•Anycast
Data dikirim dari 1 host langsung disebarkan ke host tertentu saja.

•Multicast
Data dikirim dari 1 host langsung disebarkan ke dalam group host.

ARP(Address Resolution Protocol)
DEFINISI
Merupakan standart protocol yang bertugas mengkonversi protocol address menjadi hardware address.

RARP(Reverse Address Resolution protocol)
DEFINISI
Merupakan standart protocol yang bertugas mengkonversi hardware address menjadi protocol address.

BOOTP(Bootstrap Protocol)
Definisi
•Protokol yang digunakan untuk proses boot dari diskless workstation.
•Bootp dapat digunakan pada jaringan jika server dan client tsb terdapat pada LAN yang sama.

BOOTP Message Format
Proses Bootp
•Client memeriksa address hardware
•Client BOOTP mengirim hardware address dalam UDP datagram ke server
•Server menerima datagram tsb dan memeriksa hardware address tsb untuk mengetahui IP address.Server mengirim informasi tsb ke client(udp port 68).

Metode:
1.Jika Client mengetahui IP addressnya , server akan kembali mengirim hardware address ke client.
2.Jika client tidak tahu IP address maka server akan konsentrasi pada ARP cache nya.
3.ARP pada server tidak dapat berfungsi jika client tidak tahu IP Address, maka tidak dapat reply ARP request.
•Ketika sudah reply request tsb,client bootp akan mencatat IP addressnya dan proses bootstrap dilakukan.

DHCP(Dynamic Host Configuration Protocol)
Definisi
•Protokol Standart yang digunakan untuk membagi alamat IP secara otomatis.
•DHCP berbasis pada server DHCP dan Client DHCP.
•Satu server DHCP dapat melayani pemberian alamat pada beberapa jaringan. Scope adalah range alamat IP yang dipakai oleh client.
•Client DHCP meminta dan diberi lease
untuk menggunakan alamat IP dari scope yang ada.
•Client DHCP tidak diberi fasilitas menggunakan alamat IP secara permanen, dan leas diterima dalam jangka waktu tertentu.
•Client yang pindah jaringan diberi IP yang sesuai dengan jaringan tsb.
•Pemasangan server DHCP pada PC yang menjalankan Windows NT Server.
•Sistem Operasi yang berfungsi sebagai client DHCP

1.Seluruh versi Windows NT
2.Windows 95
3.Windows 3.11 dengan client TCP/IP 32 bit
4.MS DOS workgroup connection 3.0

DHCP Client dan DHCP Server Interaction
Sistem Kerja DHCP
1.Host client DHCP memulai initializing state dan broadcast discover message pada jaringan lokal.Dapat ke jaringan lain untuk ke DHCP Server.
2.Server DHCP menerima discover message dan melayani permintaan dengan respon offer message.
Offer message berisi alamat IP dan informasi konfigurasi yang sesuai
3.Client DHCP masuk tahap selecting state dan memeriksa offer message tsb.
4. Client DHCP memilih tawaran, mengirim request message ke server DHCP, meminta konfigurasi yang ditawarkan
5. Server DHCP memberikan konfigurasi tsb dengan acknowledge message berisi alamat IP dan konfigurasi serta lease selama periode tertentu.Administrator jaringan lokal mengatur lease ini.

Protocol Jaringan IPX/SPX
Protocol IPX
Mempunyai fungsi utama sebagai media transmisi data dan menjamin validitas data yang ditransmisikan oleh IPX sehingga data yang dikirim tidak mengalami gangguan atau pun terjadi kerusakan pada data. IPX dan SPX adalah protokol jaringan digunakan terutama pada jaringan menggunakan sistem operasi NovellNetWare. IPX dan SPX diturunkan dari Xerox Network Systems ‘IDP dan SPP protokol , masing-masing. IPX adalah protokol lapisan jaringan (lapisan 3 dari OSI Model), sedangkan SPX adalah protokol lapisan transport (lapisan4 dari OSI Model). SPX lapisan yang duduk diatas layer IPX dan menyediakan layanan yang berorientasi koneksi antara dua node didalam jaringan.SPX digunakan terutama oleh klien/server aplikasi. IPX menyediakan layanan data gramatas paket-switched internetwork. Operasi dasarnya mirip dengan IP (InternetProtocol), namun skema pengalamatan, struktur paket, dan cakupan umum yang berbeda.Protokol internet working beroperasi dilapisan jaringan dan mencakup layanan routing.

Protokol SPX
•Protokol SPX (sequencing Paket Exchange), yang berada di lapisan transport. Jika dibandingkan dengan TCP / IP protocol suite, IPX routing dan menyediakan layanan internetwork serupa dengan IP, dan SPX menyediakan layanan lapisan transport serupa dengan TCP. IPX dan IP adalah connectionless datagram protokol, sementara SPX dan TCP merupakan protokol berorientasi koneksi.

Protocol TCP/IP
Pada TCP/IP terdapat beberapa protokol sub yang menangani masalah komunikasi antar komputer. TCP/IP mengimplemenasikan arsitektur ber lapis yang terdiri atas empat lapis,diantaranya adalah.
1.Protokol lapisan aplikasi : bertanggung jawab untuk menyediakan akses kepada aplikasi terhadap layanan jaringan TCP/IP. Protokol ini mencakup protokol DynamicHost Configuration Protocol (DHCP), Domain Name System(DNS), Hypertext Transfer Protocol (HTTP), File Transfer Protocol (FTP), Telnet, Simple Mail Transfer Protocol (SMTP), Simple Network Management Protocol (SNMP),dan masih banyak protokol lainnya.Dalam beberapa implementasi stack protokol,seperti halnya Microsof tTCP/IP,protokol-protokol lapisan aplikasi berinteraksi dengan menggunakan antar muka Windows Sockets (Winsock) atau Net BIO Sover TCP/IP (NetBT).

Protocol TCP/IP
2. Protokol lapisan antar – host : berguna untuk membuat komunikasi menggunakan sesi koneksi yang bersifat connection-oriented atau broadcast yang bersifat connectionless. Protokol dalam lapisan ini adalah Transmission Control Protocol (TCP) dan User Datagram Protocol(UDP).
3.Protokol lapisan internet work : bertanggung jawab untuk melakukan pemetaan (routing) dan enkapsulasi paket-paket data jaringan menjadi paket – paket IP. Protokol yang bekerja dalam lapisan ini adalah Internet Protocol(IP), Address Resolution Protocol(ARP), Internet Control Message Protocol (ICMP), dan Internet Group Management Protocol (IGMP).
4.Protokol lapisan antar muka jaringan : bertanggung jawab untuk meletakkan frame-frame jaringan diatas media jaringan yang digunakan. TCP/IP dapat bekerja dengan banyak teknologi transport, mulai dari teknologi transport dalam LAN (seperti hal nya Ethernet dan Token Ring),MAN dan WAN (seperti hal nya dial-up modem yang berjalan diatas Public Switched Telephone Network (PSTN), Integrated Services Digital Network (ISDN), serta Asynchronous Transfer Mode(ATM) .